| UniProt ID | WASC3_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y3C0 | |
| Protein Name | WASH complex subunit 3 {ECO:0000312|HGNC:HGNC:24256} | |
| Gene Name | WASHC3 {ECO:0000312|HGNC:HGNC:24256} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 194 | |
| Subcellular Localization | Early endosome . | |
| Protein Description | Acts at least in part as component of the WASH core complex whose assembly at the surface of endosomes seems to inhibit WASH nucleation-promoting factor (NPF) activity in recruiting and activating the Arp2/3 complex to induce actin polymerization, and which is involved in regulation of the fission of tubules that serve as transport intermediates during endosome sorting. [PubMed: 19922875] | |
| Protein Sequence | MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDEDGLPL -------CCCCCCCC | 22814378 | ||
| 11 | Phosphorylation | DGLPLMGSGIDLTKV CCCCCCCCCCCCCCC | 22199227 | ||
| 16 | Phosphorylation | MGSGIDLTKVPAIQQ CCCCCCCCCCCHHHC | 29514088 | ||
| 24 | Ubiquitination | KVPAIQQKRTVAFLN CCCHHHCHHHHHHHH | - | ||
| 24 | 2-Hydroxyisobutyrylation | KVPAIQQKRTVAFLN CCCHHHCHHHHHHHH | - | ||
| 51 | Ubiquitination | FSTVCEEKLADLSLR HHHHHHHHHHHHHHH | - | ||
| 56 | Phosphorylation | EEKLADLSLRIQQIE HHHHHHHHHHHHHHH | 24719451 | ||
| 178 | Phosphorylation | APVPDGESEKTVEES CCCCCCCCCCCCCCC | 25159151 | ||
| 180 | Acetylation | VPDGESEKTVEESSD CCCCCCCCCCCCCCC | 19821101 | ||
| 181 | Phosphorylation | PDGESEKTVEESSDS CCCCCCCCCCCCCCC | 29514088 | ||
| 185 | Phosphorylation | SEKTVEESSDSESSF CCCCCCCCCCCCCCC | 29514088 | ||
| 186 | Phosphorylation | EKTVEESSDSESSFS CCCCCCCCCCCCCCC | 29514088 | ||
| 188 | Phosphorylation | TVEESSDSESSFSD- CCCCCCCCCCCCCC- | 24719451 | ||
| 190 | Phosphorylation | EESSDSESSFSD--- CCCCCCCCCCCC--- | 28348404 | ||
| 191 | Phosphorylation | ESSDSESSFSD---- CCCCCCCCCCC---- | 28348404 | ||
| 193 | Phosphorylation | SDSESSFSD------ CCCCCCCCC------ | 23909892 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WASC3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WASC3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WASC3_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
