| UniProt ID | ZFP1_HUMAN | |
|---|---|---|
| UniProt AC | Q6P2D0 | |
| Protein Name | Zinc finger protein 1 homolog | |
| Gene Name | ZFP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 407 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MNKSQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDHRNPDEQARQFLILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLLNSNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 (in isoform 2) | Ubiquitination | - | 46.75 | 21890473 | |
| 33 (in isoform 2) | Ubiquitination | - | 6.73 | 21890473 | |
| 50 (in isoform 2) | Ubiquitination | - | 4.07 | 21890473 | |
| 56 (in isoform 2) | Ubiquitination | - | 6.16 | 21890473 | |
| 59 (in isoform 2) | Ubiquitination | - | 31.62 | 21890473 | |
| 74 | Sumoylation | ARQFLILKNQTPIEE HHHHHHHCCCCCHHH | 39.76 | 28112733 | |
| 74 (in isoform 1) | Ubiquitination | - | 39.76 | 21890473 | |
| 74 | Ubiquitination | ARQFLILKNQTPIEE HHHHHHHCCCCCHHH | 39.76 | 21890473 | |
| 77 | Phosphorylation | FLILKNQTPIEERGD HHHHCCCCCHHHHHC | 35.31 | 28555341 | |
| 88 | Ubiquitination | ERGDLFGKALNLNTD HHHCHHHHHHCCCCC | 42.22 | 21890473 | |
| 88 (in isoform 1) | Ubiquitination | - | 42.22 | 21890473 | |
| 105 (in isoform 1) | Ubiquitination | - | 26.64 | 21890473 | |
| 105 | Ubiquitination | SLRQVPYKYDLYEKT EHHCCCCCCCHHHHH | 26.64 | 21890473 | |
| 111 (in isoform 1) | Ubiquitination | - | 45.67 | 21890473 | |
| 111 | Ubiquitination | YKYDLYEKTLKYNSD CCCCHHHHHHHCCHH | 45.67 | 21890473 | |
| 114 | Ubiquitination | DLYEKTLKYNSDLLN CHHHHHHHCCHHHCC | 47.84 | 21890473 | |
| 114 (in isoform 1) | Ubiquitination | - | 47.84 | 21890473 | |
| 114 | Sumoylation | DLYEKTLKYNSDLLN CHHHHHHHCCHHHCC | 47.84 | - | |
| 114 | Sumoylation | DLYEKTLKYNSDLLN CHHHHHHHCCHHHCC | 47.84 | 28112733 | |
| 129 | Ubiquitination | SNRSYAGKQTDECNE CCCCCCCCCCHHHHH | 41.68 | - | |
| 139 | Ubiquitination | DECNEFGKALLYLKQ HHHHHHHHHHHHHHH | 40.98 | - | |
| 141 (in isoform 2) | Ubiquitination | - | 3.53 | 21890473 | |
| 145 | Ubiquitination | GKALLYLKQEKTHSG HHHHHHHHHHCCCCC | 42.74 | - | |
| 145 | Sumoylation | GKALLYLKQEKTHSG HHHHHHHHHHCCCCC | 42.74 | - | |
| 145 | Sumoylation | GKALLYLKQEKTHSG HHHHHHHHHHCCCCC | 42.74 | 28112733 | |
| 155 | Phosphorylation | KTHSGVEYSEYNKSG CCCCCCCHHHCCCCC | 12.37 | 27642862 | |
| 160 | Ubiquitination | VEYSEYNKSGKALSH CCHHHCCCCCCCHHH | 60.73 | - | |
| 168 | Ubiquitination | SGKALSHKAAIFKHQ CCCCHHHHHHHHHHH | 35.82 | - | |
| 173 | Ubiquitination | SHKAAIFKHQKIKNL HHHHHHHHHHHHHHH | 38.73 | - | |
| 194 | Phosphorylation | TYCDKAFSFKSLLIS HHCCCCCCHHHHHHC | 36.30 | 24719451 | |
| 196 | Ubiquitination | CDKAFSFKSLLISHK CCCCCCHHHHHHCCC | 38.71 | 21890473 | |
| 196 (in isoform 1) | Ubiquitination | - | 38.71 | 21890473 | |
| 197 | Phosphorylation | DKAFSFKSLLISHKR CCCCCHHHHHHCCCC | 26.80 | - | |
| 201 | Phosphorylation | SFKSLLISHKRIHTG CHHHHHHCCCCCCCC | 23.95 | - | |
| 207 | Phosphorylation | ISHKRIHTGEKPYEC HCCCCCCCCCCCCCC | 44.67 | 28111955 | |
| 224 | Ubiquitination | CKKTFSHKANLIKHQ CCCCCCCCCCCCCCC | 37.46 | - | |
| 235 | Phosphorylation | IKHQRIHTGEKPFEC CCCCCCCCCCCCCCC | 44.67 | 28555341 | |
| 275 | Ubiquitination | YECSECGKTFAQKFE EECCCCCHHHHHHCC | 52.72 | - | |
| 280 | Ubiquitination | CGKTFAQKFELTTHQ CCHHHHHHCCCCCCC | 37.06 | - | |
| 291 | Phosphorylation | TTHQRIHTGERPYEC CCCCEECCCCCCCCC | 38.06 | 25159151 | |
| 316 | Ubiquitination | SNLIIHQKIHTGEKR CCEEEEEEEECCCCE | 23.46 | - | |
| 345 | Phosphorylation | QLIIHMRTHTGEKPY EEEEEEECCCCCCCE | 19.06 | - | |
| 347 | Phosphorylation | IIHMRTHTGEKPYEC EEEEECCCCCCCEEE | 46.56 | - | |
| 375 | Phosphorylation | RLHLRIHTGEKPYEC EEEEEEECCCCCEEC | 44.67 | 29496963 | |
| 380 | Phosphorylation | IHTGEKPYECSECGK EECCCCCEECCCCCC | 40.41 | - | |
| 383 | Phosphorylation | GEKPYECSECGKAFS CCCCEECCCCCCCCC | 24.79 | 27251275 | |
| 387 | Ubiquitination | YECSECGKAFSRKSR EECCCCCCCCCCCCC | 58.90 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZFP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZFP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZFP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HDAC2_HUMAN | HDAC2 | physical | 21540836 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
