| UniProt ID | HDAC2_HUMAN | |
|---|---|---|
| UniProt AC | Q92769 | |
| Protein Name | Histone deacetylase 2 | |
| Gene Name | HDAC2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 488 | |
| Subcellular Localization | Nucleus . Cytoplasm . | |
| Protein Description | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.. | |
| Protein Sequence | MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAYSQGGGKKK ----CCCCCCCCCCE | 16.89 | 28348404 | |
| 9 | 2-Hydroxyisobutyrylation | AYSQGGGKKKVCYYY CCCCCCCCCEEEEEE | 53.33 | - | |
| 9 | Ubiquitination | AYSQGGGKKKVCYYY CCCCCCCCCEEEEEE | 53.33 | 33845483 | |
| 10 | Ubiquitination | YSQGGGKKKVCYYYD CCCCCCCCEEEEEEC | 54.43 | 22817900 | |
| 11 | Ubiquitination | SQGGGKKKVCYYYDG CCCCCCCEEEEEECC | 40.81 | 21890473 | |
| 11 (in isoform 1) | Ubiquitination | - | 40.81 | 21890473 | |
| 21 | Ubiquitination | YYYDGDIGNYYYGQG EEECCCCCCEEECCC | 22.34 | - | |
| 21 | Ubiquitination | YYYDGDIGNYYYGQG EEECCCCCCEEECCC | 22.34 | 27667366 | |
| 29 | Ubiquitination | NYYYGQGHPMKPHRI CEEECCCCCCCCCEE | 16.05 | - | |
| 32 | Acetylation | YGQGHPMKPHRIRMT ECCCCCCCCCEECCH | 41.97 | 27452117 | |
| 32 | Ubiquitination | YGQGHPMKPHRIRMT ECCCCCCCCCEECCH | 41.97 | 21963094 | |
| 37 | Acetylation | PMKPHRIRMTHNLLL CCCCCEECCHHHHHH | 24.73 | - | |
| 37 | Ubiquitination | PMKPHRIRMTHNLLL CCCCCEECCHHHHHH | 24.73 | - | |
| 37 | Methylation | PMKPHRIRMTHNLLL CCCCCEECCHHHHHH | 24.73 | - | |
| 37 | Ubiquitination | PMKPHRIRMTHNLLL CCCCCEECCHHHHHH | 24.73 | 21890473 | |
| 39 | Phosphorylation | KPHRIRMTHNLLLNY CCCEECCHHHHHHHH | 9.58 | 24719451 | |
| 45 | Ubiquitination | MTHNLLLNYGLYRKM CHHHHHHHHHHHHCC | 28.88 | - | |
| 45 | Ubiquitination | MTHNLLLNYGLYRKM CHHHHHHHHHHHHCC | 28.88 | 23000965 | |
| 46 | Phosphorylation | THNLLLNYGLYRKME HHHHHHHHHHHHCCE | 14.42 | 28258704 | |
| 49 | Phosphorylation | LLLNYGLYRKMEIYR HHHHHHHHHCCEEEC | 12.11 | 24719451 | |
| 51 | Ubiquitination | LNYGLYRKMEIYRPH HHHHHHHCCEEECCC | 27.59 | 27667366 | |
| 55 | Phosphorylation | LYRKMEIYRPHKATA HHHCCEEECCCCCCH | 12.56 | 28258704 | |
| 59 | Ubiquitination | MEIYRPHKATAEEMT CEEECCCCCCHHHHH | 50.55 | 29967540 | |
| 60 | Acetylation | EIYRPHKATAEEMTK EEECCCCCCHHHHHH | 14.70 | - | |
| 60 | Ubiquitination | EIYRPHKATAEEMTK EEECCCCCCHHHHHH | 14.70 | - | |
| 60 | Ubiquitination | EIYRPHKATAEEMTK EEECCCCCCHHHHHH | 14.70 | 23000965 | |
| 61 | Phosphorylation | IYRPHKATAEEMTKY EECCCCCCHHHHHHH | 39.13 | - | |
| 65 | Sulfoxidation | HKATAEEMTKYHSDE CCCCHHHHHHHCCHH | 2.70 | 30846556 | |
| 66 | Phosphorylation | KATAEEMTKYHSDEY CCCHHHHHHHCCHHH | 31.56 | 29496907 | |
| 67 | Acetylation | ATAEEMTKYHSDEYI CCHHHHHHHCCHHHH | 39.39 | 23236377 | |
| 67 | Ubiquitination | ATAEEMTKYHSDEYI CCHHHHHHHCCHHHH | 39.39 | 21963094 | |
| 67 (in isoform 1) | Ubiquitination | - | 39.39 | 21890473 | |
| 68 | Nitration | TAEEMTKYHSDEYIK CHHHHHHHCCHHHHH | 9.44 | - | |
| 68 | Phosphorylation | TAEEMTKYHSDEYIK CHHHHHHHCCHHHHH | 9.44 | 28152594 | |
| 70 | Phosphorylation | EEMTKYHSDEYIKFL HHHHHHCCHHHHHHH | 29.10 | 28152594 | |
| 73 | Nitration | TKYHSDEYIKFLRSI HHHCCHHHHHHHHHH | 17.88 | - | |
| 73 | Phosphorylation | TKYHSDEYIKFLRSI HHHCCHHHHHHHHHH | 17.88 | 30576142 | |
| 75 | Acetylation | YHSDEYIKFLRSIRP HCCHHHHHHHHHHCC | 37.13 | 19608861 | |
| 75 | Sumoylation | YHSDEYIKFLRSIRP HCCHHHHHHHHHHCC | 37.13 | 28112733 | |
| 75 | Ubiquitination | YHSDEYIKFLRSIRP HCCHHHHHHHHHHCC | 37.13 | 23000965 | |
| 75 (in isoform 1) | Ubiquitination | - | 37.13 | 21890473 | |
| 86 | Phosphorylation | SIRPDNMSEYSKQMQ HHCCCCHHHHHHHHH | 39.37 | 28450419 | |
| 88 | Phosphorylation | RPDNMSEYSKQMQRF CCCCHHHHHHHHHHC | 17.54 | - | |
| 89 | Phosphorylation | PDNMSEYSKQMQRFN CCCHHHHHHHHHHCC | 16.62 | 20860994 | |
| 90 | Sumoylation | DNMSEYSKQMQRFNV CCHHHHHHHHHHCCC | 49.22 | - | |
| 90 | Acetylation | DNMSEYSKQMQRFNV CCHHHHHHHHHHCCC | 49.22 | 22641419 | |
| 90 | Methylation | DNMSEYSKQMQRFNV CCHHHHHHHHHHCCC | 49.22 | 22641419 | |
| 90 | Neddylation | DNMSEYSKQMQRFNV CCHHHHHHHHHHCCC | 49.22 | 32015554 | |
| 90 | Sumoylation | DNMSEYSKQMQRFNV CCHHHHHHHHHHCCC | 49.22 | - | |
| 90 | Ubiquitination | DNMSEYSKQMQRFNV CCHHHHHHHHHHCCC | 49.22 | 27667366 | |
| 90 (in isoform 1) | Ubiquitination | - | 49.22 | 21890473 | |
| 115 | Ubiquitination | FEFCQLSTGGSVAGA HHHCCCCCCCCHHHE | 54.90 | - | |
| 144 | Ubiquitination | AGGLHHAKKSEASGF CCCCCCCCHHCCCCC | 53.10 | 29967540 | |
| 145 | Ubiquitination | GGLHHAKKSEASGFC CCCCCCCHHCCCCCH | 55.07 | - | |
| 167 | Nitration | AILELLKYHQRVLYI HHHHHHHHHCCEEEE | 11.80 | - | |
| 171 | Ubiquitination | LLKYHQRVLYIDIDI HHHHHCCEEEEEEEE | 3.71 | - | |
| 171 | Ubiquitination | LLKYHQRVLYIDIDI HHHHHCCEEEEEEEE | 3.71 | 21890473 | |
| 173 | Nitration | KYHQRVLYIDIDIHH HHHCCEEEEEEEECC | 8.16 | - | |
| 189 | Ubiquitination | DGVEEAFYTTDRVMT CCHHHEEEECCCEEE | 18.77 | 22817900 | |
| 191 | Acetylation | VEEAFYTTDRVMTVS HHHEEEECCCEEEEE | 15.49 | - | |
| 191 | Ubiquitination | VEEAFYTTDRVMTVS HHHEEEECCCEEEEE | 15.49 | - | |
| 191 | Ubiquitination | VEEAFYTTDRVMTVS HHHEEEECCCEEEEE | 15.49 | 21963094 | |
| 196 | Phosphorylation | YTTDRVMTVSFHKYG EECCCEEEEEEEECC | 15.33 | 20068231 | |
| 198 | Phosphorylation | TDRVMTVSFHKYGEY CCCEEEEEEEECCCC | 16.68 | 20068231 | |
| 201 | Ubiquitination | VMTVSFHKYGEYFPG EEEEEEEECCCCCCC | 53.60 | 23000965 | |
| 201 (in isoform 1) | Ubiquitination | - | 53.60 | 21890473 | |
| 202 | Phosphorylation | MTVSFHKYGEYFPGT EEEEEEECCCCCCCC | 13.45 | 28152594 | |
| 205 | Phosphorylation | SFHKYGEYFPGTGDL EEEECCCCCCCCCCC | 15.65 | 28152594 | |
| 213 | Ubiquitination | FPGTGDLRDIGAGKG CCCCCCCEECCCCCC | 37.94 | - | |
| 213 | Ubiquitination | FPGTGDLRDIGAGKG CCCCCCCEECCCCCC | 37.94 | 23000965 | |
| 218 | Ubiquitination | DLRDIGAGKGKYYAV CCEECCCCCCCEEEE | 33.75 | 23000965 | |
| 219 | Ubiquitination | LRDIGAGKGKYYAVN CEECCCCCCCEEEEE | 52.26 | 22817900 | |
| 221 | Acetylation | DIGAGKGKYYAVNFP ECCCCCCCEEEEEEE | 38.28 | 25953088 | |
| 221 | Ubiquitination | DIGAGKGKYYAVNFP ECCCCCCCEEEEEEE | 38.28 | 21963094 | |
| 222 | Phosphorylation | IGAGKGKYYAVNFPM CCCCCCCEEEEEEEC | 12.82 | 27811184 | |
| 237 | Phosphorylation | RDGIDDESYGQIFKP CCCCCCCCHHHHHHH | 41.37 | 20068231 | |
| 238 | Phosphorylation | DGIDDESYGQIFKPI CCCCCCCHHHHHHHH | 15.82 | 23090842 | |
| 243 | Acetylation | ESYGQIFKPIISKVM CCHHHHHHHHHHHHH | 36.62 | 26051181 | |
| 243 | Neddylation | ESYGQIFKPIISKVM CCHHHHHHHHHHHHH | 36.62 | 32015554 | |
| 243 | Ubiquitination | ESYGQIFKPIISKVM CCHHHHHHHHHHHHH | 36.62 | 23000965 | |
| 243 (in isoform 1) | Ubiquitination | - | 36.62 | 21890473 | |
| 248 | Ubiquitination | IFKPIISKVMEMYQP HHHHHHHHHHHHHCC | 34.88 | 23000965 | |
| 250 | Ubiquitination | KPIISKVMEMYQPSA HHHHHHHHHHHCCCE | 2.55 | - | |
| 250 | Ubiquitination | KPIISKVMEMYQPSA HHHHHHHHHHHCCCE | 2.55 | 21963094 | |
| 253 | Nitration | ISKVMEMYQPSAVVL HHHHHHHHCCCEEEE | 12.17 | - | |
| 254 | Ubiquitination | SKVMEMYQPSAVVLQ HHHHHHHCCCEEEEE | 24.94 | - | |
| 254 | Ubiquitination | SKVMEMYQPSAVVLQ HHHHHHHCCCEEEEE | 24.94 | 22817900 | |
| 262 | S-nitrosocysteine | PSAVVLQCGADSLSG CCEEEEECCCCCCCC | 4.19 | - | |
| 262 | S-nitrosylation | PSAVVLQCGADSLSG CCEEEEECCCCCCCC | 4.19 | 19047631 | |
| 274 | S-nitrosocysteine | LSGDRLGCFNLTVKG CCCCCEECEEEEECC | 2.12 | - | |
| 274 | S-nitrosylation | LSGDRLGCFNLTVKG CCCCCEECEEEEECC | 2.12 | 19047631 | |
| 280 | Ubiquitination | GCFNLTVKGHAKCVE ECEEEEECCCCEEEE | 39.48 | 21963094 | |
| 284 | Ubiquitination | LTVKGHAKCVEVVKT EEECCCCEEEEEEHH | 32.89 | 22817900 | |
| 291 | Phosphorylation | KCVEVVKTFNLPLLM EEEEEEHHCCCCEEE | 13.22 | 20068231 | |
| 304 | Phosphorylation | LMLGGGGYTIRNVAR EEECCCCCHHHCHHH | 11.41 | 20068231 | |
| 305 | Phosphorylation | MLGGGGYTIRNVARC EECCCCCHHHCHHHC | 19.41 | 17081983 | |
| 332 | Acetylation | IPNELPYNDYFEYFG CCCCCCCCCCHHHHC | 35.25 | - | |
| 332 | Ubiquitination | IPNELPYNDYFEYFG CCCCCCCCCCHHHHC | 35.25 | 21890473 | |
| 332 | Ubiquitination | IPNELPYNDYFEYFG CCCCCCCCCCHHHHC | 35.25 | 21963094 | |
| 334 | Ubiquitination | NELPYNDYFEYFGPD CCCCCCCCHHHHCCC | 8.48 | - | |
| 334 | Phosphorylation | NELPYNDYFEYFGPD CCCCCCCCHHHHCCC | 8.48 | - | |
| 334 | Ubiquitination | NELPYNDYFEYFGPD CCCCCCCCHHHHCCC | 8.48 | 22817900 | |
| 337 | Phosphorylation | PYNDYFEYFGPDFKL CCCCCHHHHCCCCEE | 12.16 | - | |
| 343 | Sumoylation | EYFGPDFKLHISPSN HHHCCCCEEEECCCC | 46.68 | - | |
| 347 | Phosphorylation | PDFKLHISPSNMTNQ CCCEEEECCCCCCCC | 16.13 | 27050516 | |
| 349 | Phosphorylation | FKLHISPSNMTNQNT CEEEECCCCCCCCCC | 32.23 | 29214152 | |
| 356 | Phosphorylation | SNMTNQNTPEYMEKI CCCCCCCCHHHHHHH | 14.03 | 25159151 | |
| 359 | Phosphorylation | TNQNTPEYMEKIKQR CCCCCHHHHHHHHHH | 16.27 | 28064214 | |
| 362 | Acetylation | NTPEYMEKIKQRLFE CCHHHHHHHHHHHHH | 38.38 | 23236377 | |
| 362 | Neddylation | NTPEYMEKIKQRLFE CCHHHHHHHHHHHHH | 38.38 | 32015554 | |
| 362 | Ubiquitination | NTPEYMEKIKQRLFE CCHHHHHHHHHHHHH | 38.38 | 21963094 | |
| 362 (in isoform 1) | Ubiquitination | - | 38.38 | 21890473 | |
| 364 | Ubiquitination | PEYMEKIKQRLFENL HHHHHHHHHHHHHHH | 40.20 | 22817900 | |
| 366 | Methylation | YMEKIKQRLFENLRM HHHHHHHHHHHHHCC | 36.02 | - | |
| 394 | Phosphorylation | EDAVHEDSGDEDGED CCCCCCCCCCCCCCC | 45.20 | 29255136 | |
| 407 | O-linked_Glycosylation | EDPDKRISIRASDKR CCCCCCEEEEECCCE | 15.28 | 30379171 | |
| 407 | Phosphorylation | EDPDKRISIRASDKR CCCCCCEEEEECCCE | 15.28 | 25159151 | |
| 409 | Ubiquitination | PDKRISIRASDKRIA CCCCEEEEECCCEEE | 22.65 | - | |
| 409 | Ubiquitination | PDKRISIRASDKRIA CCCCEEEEECCCEEE | 22.65 | 22053931 | |
| 410 | Ubiquitination | DKRISIRASDKRIAC CCCEEEEECCCEEEC | 22.02 | - | |
| 410 | Ubiquitination | DKRISIRASDKRIAC CCCEEEEECCCEEEC | 22.02 | 22053931 | |
| 411 | Phosphorylation | KRISIRASDKRIACD CCEEEEECCCEEECC | 33.54 | 25159151 | |
| 422 | Phosphorylation | IACDEEFSDSEDEGE EECCCCCCCCCCCCC | 43.43 | 29255136 | |
| 424 | Phosphorylation | CDEEFSDSEDEGEGG CCCCCCCCCCCCCCC | 45.83 | 29255136 | |
| 439 | 2-Hydroxyisobutyrylation | RRNVADHKKGAKKAR CCCHHHHHHHHHHHH | 54.15 | - | |
| 439 | Ubiquitination | RRNVADHKKGAKKAR CCCHHHHHHHHHHHH | 54.15 | 22053931 | |
| 440 | Ubiquitination | RNVADHKKGAKKARI CCHHHHHHHHHHHHH | 61.76 | 22053931 | |
| 452 | Sumoylation | ARIEEDKKETEDKKT HHHHHHHHHCCHHCC | 80.39 | 28112733 | |
| 458 | Sumoylation | KKETEDKKTDVKEED HHHCCHHCCCCCHHH | 63.38 | 28112733 | |
| 459 | O-linked_Glycosylation | KETEDKKTDVKEEDK HHCCHHCCCCCHHHH | 52.33 | 30379171 | |
| 462 | Sumoylation | EDKKTDVKEEDKSKD CHHCCCCCHHHHCCC | 59.19 | - | |
| 462 | Sumoylation | EDKKTDVKEEDKSKD CHHCCCCCHHHHCCC | 59.19 | 28112733 | |
| 477 | Phosphorylation | NSGEKTDTKGTKSEQ CCCCCCCCCCCCHHH | 36.28 | - | |
| 478 | Sumoylation | SGEKTDTKGTKSEQL CCCCCCCCCCCHHHC | 68.35 | 28112733 | |
| 481 | Sumoylation | KTDTKGTKSEQLSNP CCCCCCCCHHHCCCC | 61.74 | - | |
| 481 | Acetylation | KTDTKGTKSEQLSNP CCCCCCCCHHHCCCC | 61.74 | 26051181 | |
| 481 | Sumoylation | KTDTKGTKSEQLSNP CCCCCCCCHHHCCCC | 61.74 | 28112733 | |
| 481 | Ubiquitination | KTDTKGTKSEQLSNP CCCCCCCCHHHCCCC | 61.74 | 33845483 | |
| 486 | Phosphorylation | GTKSEQLSNP----- CCCHHHCCCC----- | 46.91 | 28985074 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 222 | Y | Phosphorylation | Kinase | ABL1 | P00519 | GPS |
| 394 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
| 394 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
| 394 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
| 422 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
| 422 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
| 424 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
| 424 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
| - | K | Ubiquitination | E3 ubiquitin ligase | HUWE1 | Q7Z6Z7 | PMID:22016339 |
| - | K | Ubiquitination | E3 ubiquitin ligase | RLIM | Q9NVW2 | PMID:12840003 |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 262 | C | Acetylation |
| - |
| 262 | C | S-nitrosylation |
| - |
| 274 | C | Acetylation |
| - |
| 274 | C | S-nitrosylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HDAC2_HUMAN !! | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-75 AND LYS-90, AND MASSSPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394; SER-422 ANDSER-424, AND MASS SPECTROMETRY. | |
| "Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394, AND MASSSPECTROMETRY. | |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394; SER-422 ANDSER-424, AND MASS SPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394; SER-407; SER-422AND SER-424, AND MASS SPECTROMETRY. | |
| "Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394, AND MASSSPECTROMETRY. | |
| "Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394, AND MASSSPECTROMETRY. | |
| "Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry."; Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.; Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-407; SER-422 ANDSER-424, AND MASS SPECTROMETRY. | |
| "Phosphoproteome analysis of the human mitotic spindle."; Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.; Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394, AND MASSSPECTROMETRY. | |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394; SER-422 ANDSER-424, AND MASS SPECTROMETRY. | |
