UniProt ID | SYNC_HUMAN | |
---|---|---|
UniProt AC | O43776 | |
Protein Name | Asparagine--tRNA ligase, cytoplasmic | |
Gene Name | NARS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 548 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | YVSDREGSDATGDGT EEECCCCCCCCCCCC | 21.22 | 25159151 | |
22 | Ubiquitination | DATGDGTKEKPFKTG CCCCCCCCCCCCCHH | 70.08 | 33845483 | |
31 | Ubiquitination | KPFKTGLKALMTVGK CCCCHHHHHHHHCCC | 40.60 | 29967540 | |
34 | Sulfoxidation | KTGLKALMTVGKEPF CHHHHHHHHCCCCCC | 3.22 | 30846556 | |
38 | Ubiquitination | KALMTVGKEPFPTIY HHHHHCCCCCCCEEE | 58.85 | 29967540 | |
45 | Nitration | KEPFPTIYVDSQKEN CCCCCEEEECCCCCH | 10.73 | - | |
50 | 2-Hydroxyisobutyrylation | TIYVDSQKENERWNV EEEECCCCCHHCCEE | 67.47 | - | |
50 | Ubiquitination | TIYVDSQKENERWNV EEEECCCCCHHCCEE | 67.47 | 32015554 | |
50 | Acetylation | TIYVDSQKENERWNV EEEECCCCCHHCCEE | 67.47 | 26051181 | |
59 | Phosphorylation | NERWNVISKSQLKNI HHCCEECCHHHHHHH | 23.21 | 29978859 | |
59 | Ubiquitination | NERWNVISKSQLKNI HHCCEECCHHHHHHH | 23.21 | 21890473 | |
60 | Ubiquitination | ERWNVISKSQLKNIK HCCEECCHHHHHHHH | 30.97 | 21890473 | |
60 | Ubiquitination | ERWNVISKSQLKNIK HCCEECCHHHHHHHH | 30.97 | 22817900 | |
60 | Malonylation | ERWNVISKSQLKNIK HCCEECCHHHHHHHH | 30.97 | 26320211 | |
60 | Acetylation | ERWNVISKSQLKNIK HCCEECCHHHHHHHH | 30.97 | 25953088 | |
61 | Phosphorylation | RWNVISKSQLKNIKK CCEECCHHHHHHHHH | 33.67 | 26055452 | |
63 | Ubiquitination | NVISKSQLKNIKKMW EECCHHHHHHHHHHH | 6.22 | 22817900 | |
64 | Ubiquitination | VISKSQLKNIKKMWH ECCHHHHHHHHHHHH | 49.33 | 22817900 | |
64 | Acetylation | VISKSQLKNIKKMWH ECCHHHHHHHHHHHH | 49.33 | 25953088 | |
77 | Phosphorylation | WHREQMKSESREKKE HHHHHHHHHHHHHHH | 35.15 | 24719451 | |
81 | Ubiquitination | QMKSESREKKEAEDS HHHHHHHHHHHHHHH | 77.18 | 24816145 | |
82 | Ubiquitination | MKSESREKKEAEDSL HHHHHHHHHHHHHHH | 55.60 | 24816145 | |
83 | Ubiquitination | KSESREKKEAEDSLR HHHHHHHHHHHHHHH | 58.36 | 24816145 | |
88 | Phosphorylation | EKKEAEDSLRREKNL HHHHHHHHHHHHHCH | 18.45 | 29255136 | |
93 | Ubiquitination | EDSLRREKNLEEAKK HHHHHHHHCHHHHHC | 66.09 | 29967540 | |
98 | Ubiquitination | REKNLEEAKKITIKN HHHCHHHHHCCEECC | 14.74 | 23000965 | |
99 | Ubiquitination | EKNLEEAKKITIKND HHCHHHHHCCEECCC | 48.24 | 23000965 | |
99 | 2-Hydroxyisobutyrylation | EKNLEEAKKITIKND HHCHHHHHCCEECCC | 48.24 | - | |
100 | Ubiquitination | KNLEEAKKITIKNDP HCHHHHHCCEECCCC | 52.72 | 23000965 | |
100 | Acetylation | KNLEEAKKITIKNDP HCHHHHHCCEECCCC | 52.72 | 7677539 | |
102 | Phosphorylation | LEEAKKITIKNDPSL HHHHHCCEECCCCCC | 34.48 | 24719451 | |
103 | Ubiquitination | EEAKKITIKNDPSLP HHHHCCEECCCCCCC | 4.46 | 21890473 | |
104 | Ubiquitination | EAKKITIKNDPSLPE HHHCCEECCCCCCCC | 46.80 | 21890473 | |
104 | Ubiquitination | EAKKITIKNDPSLPE HHHCCEECCCCCCCC | 46.80 | 23000965 | |
104 | Acetylation | EAKKITIKNDPSLPE HHHCCEECCCCCCCC | 46.80 | 25953088 | |
113 | Ubiquitination | DPSLPEPKCVKIGAL CCCCCCCCEEEEEEE | 50.42 | 29967540 | |
113 | Acetylation | DPSLPEPKCVKIGAL CCCCCCCCEEEEEEE | 50.42 | 7677549 | |
116 | Ubiquitination | LPEPKCVKIGALEGY CCCCCEEEEEEECCC | 44.91 | - | |
116 | Ubiquitination | LPEPKCVKIGALEGY CCCCCEEEEEEECCC | 44.91 | - | |
123 | Phosphorylation | KIGALEGYRGQRVKV EEEEECCCCCCEEEE | 11.38 | 28152594 | |
124 | Methylation | IGALEGYRGQRVKVF EEEECCCCCCEEEEE | 45.70 | 115484487 | |
129 | 2-Hydroxyisobutyrylation | GYRGQRVKVFGWVHR CCCCCEEEEEEHHHH | 33.75 | - | |
129 | Ubiquitination | GYRGQRVKVFGWVHR CCCCCEEEEEEHHHH | 33.75 | - | |
129 | Acetylation | GYRGQRVKVFGWVHR CCCCCEEEEEEHHHH | 33.75 | 26051181 | |
129 | Ubiquitination | GYRGQRVKVFGWVHR CCCCCEEEEEEHHHH | 33.75 | - | |
141 | Ubiquitination | VHRLRRQGKNLMFLV HHHHHHCCCCEEEEE | 21.00 | 24816145 | |
142 | Ubiquitination | HRLRRQGKNLMFLVL HHHHHCCCCEEEEEE | 38.27 | 24816145 | |
243 | Ubiquitination | MIRGENMSKILKARS EEECCCHHHHHHHHH | 28.29 | 22817900 | |
244 | Ubiquitination | IRGENMSKILKARSM EECCCHHHHHHHHHH | 41.09 | 21906983 | |
244 | Acetylation | IRGENMSKILKARSM EECCCHHHHHHHHHH | 41.09 | 19608861 | |
246 | Ubiquitination | GENMSKILKARSMVT CCCHHHHHHHHHHHH | 4.00 | 22817900 | |
247 | Ubiquitination | ENMSKILKARSMVTR CCHHHHHHHHHHHHH | 45.27 | 22817900 | |
250 | Phosphorylation | SKILKARSMVTRCFR HHHHHHHHHHHHHHH | 23.59 | 29900121 | |
253 | Phosphorylation | LKARSMVTRCFRDHF HHHHHHHHHHHHHHH | 17.06 | 29900121 | |
289 | Phosphorylation | ATLFKLDYFGEEAFL EEEEEECCCCCCEEE | 24.74 | 25332170 | |
384 | Ubiquitination | LNPNFQPPKRPFKRM CCCCCCCCCCCCCCC | 34.21 | 21890473 | |
385 | Ubiquitination | NPNFQPPKRPFKRMN CCCCCCCCCCCCCCC | 78.40 | 21890473 | |
393 | Phosphorylation | RPFKRMNYSDAIVWL CCCCCCCHHHEEEEE | 9.89 | 20068231 | |
394 | Phosphorylation | PFKRMNYSDAIVWLK CCCCCCHHHEEEEEH | 18.63 | 20068231 | |
400 | Ubiquitination | YSDAIVWLKEHDVKK HHHEEEEEHHHCCCC | 3.02 | 21963094 | |
401 | 2-Hydroxyisobutyrylation | SDAIVWLKEHDVKKE HHEEEEEHHHCCCCC | 36.97 | - | |
401 | Ubiquitination | SDAIVWLKEHDVKKE HHEEEEEHHHCCCCC | 36.97 | 21906983 | |
405 | Ubiquitination | VWLKEHDVKKEDGTF EEEHHHCCCCCCCCE | 11.71 | 22817900 | |
406 | Ubiquitination | WLKEHDVKKEDGTFY EEHHHCCCCCCCCEE | 57.41 | 22817900 | |
407 | Ubiquitination | LKEHDVKKEDGTFYE EHHHCCCCCCCCEEE | 61.97 | 21906983 | |
413 | Phosphorylation | KKEDGTFYEFGEDIP CCCCCCEEECCCCCC | 15.36 | 27642862 | |
427 | Sulfoxidation | PEAPERLMTDTINEP CCCCHHHCCCCCCCC | 3.90 | 21406390 | |
428 | Phosphorylation | EAPERLMTDTINEPI CCCHHHCCCCCCCCE | 34.28 | 25690035 | |
430 | Phosphorylation | PERLMTDTINEPILL CHHHCCCCCCCCEEE | 19.28 | 25690035 | |
438 | Glutathionylation | INEPILLCRFPVEIK CCCCEEEECCCEEEH | 3.65 | 22555962 | |
444 | Ubiquitination | LCRFPVEIKSFYMQR EECCCEEEHEEEHHH | 4.63 | 21890473 | |
445 | Ubiquitination | CRFPVEIKSFYMQRC ECCCEEEHEEEHHHC | 22.47 | 22817900 | |
451 | Methylation | IKSFYMQRCPEDSRL EHEEEHHHCCCCCCC | 22.79 | 115484495 | |
459 | Phosphorylation | CPEDSRLTESVDVLM CCCCCCCCCCCCEEC | 25.71 | 20068231 | |
461 | Phosphorylation | EDSRLTESVDVLMPN CCCCCCCCCCEECCC | 20.55 | 20068231 | |
466 | Sulfoxidation | TESVDVLMPNVGEIV CCCCCEECCCCHHHC | 1.97 | 30846556 | |
476 | Phosphorylation | VGEIVGGSMRIFDSE CHHHCCCEEEECCHH | 10.04 | 20068231 | |
477 | Sulfoxidation | GEIVGGSMRIFDSEE HHHCCCEEEECCHHH | 4.27 | 30846556 | |
482 | Phosphorylation | GSMRIFDSEEILAGY CEEEECCHHHHHHCH | 26.78 | 21082442 | |
489 | Nitration | SEEILAGYKREGIDP HHHHHHCHHCCCCCC | 10.98 | - | |
489 | Ubiquitination | SEEILAGYKREGIDP HHHHHHCHHCCCCCC | 10.98 | 23000965 | |
489 | Phosphorylation | SEEILAGYKREGIDP HHHHHHCHHCCCCCC | 10.98 | 28152594 | |
490 | Malonylation | EEILAGYKREGIDPT HHHHHCHHCCCCCCC | 42.95 | 26320211 | |
490 | 2-Hydroxyisobutyrylation | EEILAGYKREGIDPT HHHHHCHHCCCCCCC | 42.95 | - | |
490 | Acetylation | EEILAGYKREGIDPT HHHHHCHHCCCCCCC | 42.95 | 25953088 | |
490 | Ubiquitination | EEILAGYKREGIDPT HHHHHCHHCCCCCCC | 42.95 | 23000965 | |
497 | Phosphorylation | KREGIDPTPYYWYTD HCCCCCCCCCEEECC | 21.85 | 28152594 | |
499 | Phosphorylation | EGIDPTPYYWYTDQR CCCCCCCCEEECCCC | 14.76 | 28152594 | |
500 | Phosphorylation | GIDPTPYYWYTDQRK CCCCCCCEEECCCCC | 7.98 | 28152594 | |
502 | Phosphorylation | DPTPYYWYTDQRKYG CCCCCEEECCCCCCC | 5.59 | 28152594 | |
503 | Phosphorylation | PTPYYWYTDQRKYGT CCCCEEECCCCCCCC | 16.12 | 28152594 | |
506 | Ubiquitination | YYWYTDQRKYGTCPH CEEECCCCCCCCCCC | 36.65 | 21890473 | |
507 | 2-Hydroxyisobutyrylation | YWYTDQRKYGTCPHG EEECCCCCCCCCCCC | 42.26 | - | |
507 | Ubiquitination | YWYTDQRKYGTCPHG EEECCCCCCCCCCCC | 42.26 | 22817900 | |
507 | Acetylation | YWYTDQRKYGTCPHG EEECCCCCCCCCCCC | 42.26 | 25953088 | |
539 | Phosphorylation | HIRDVCLYPRFVQRC CHHHHHCCHHHHCCC | 6.29 | 27273156 | |
547 | Phosphorylation | PRFVQRCTP------ HHHHCCCCC------ | 33.93 | 22199227 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYNC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYNC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYNC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYRC_HUMAN | RARS | physical | 22939629 | |
C1QBP_HUMAN | C1QBP | physical | 22863883 | |
CUL2_HUMAN | CUL2 | physical | 22863883 | |
IF4B_HUMAN | EIF4B | physical | 22863883 | |
GANAB_HUMAN | GANAB | physical | 22863883 | |
PLAK_HUMAN | JUP | physical | 22863883 | |
PAPOA_HUMAN | PAPOLA | physical | 22863883 | |
PLOD2_HUMAN | PLOD2 | physical | 22863883 | |
ANM3_HUMAN | PRMT3 | physical | 22863883 | |
TRUA_HUMAN | PUS1 | physical | 22863883 | |
RL24_HUMAN | RPL24 | physical | 22863883 | |
SAMH1_HUMAN | SAMHD1 | physical | 22863883 | |
SC23A_HUMAN | SEC23A | physical | 22863883 | |
SF01_HUMAN | SF1 | physical | 22863883 | |
TRM1_HUMAN | TRMT1 | physical | 22863883 | |
XPO7_HUMAN | XPO7 | physical | 22863883 | |
XRCC6_HUMAN | XRCC6 | physical | 22863883 | |
SYIC_HUMAN | IARS | physical | 26344197 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00174 | L-Asparagine |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-244, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-61, AND MASSSPECTROMETRY. |