dbPTM

DEC1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DEC1_HUMAN
UniProt AC	Q9P2X7
Protein Name	Deleted in esophageal cancer 1
Gene Name	1-Dec
Organism	Homo sapiens (Human).
Sequence Length	70
Subcellular Localization
Protein Description	Candidate tumor suppressor..
Protein Sequence	MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MTMNVLEAG ------CCCCCCCCC	19.90	30177828
58	Phosphorylation	GGKDFAVSLARPKAA CCCCEEEEECCHHHH	16.94	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DEC1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DEC1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DEC1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDAC2_HUMAN	HDAC2	physical	21317427
HDAC1_HUMAN	HDAC1	physical	20821348
DEC1_HUMAN	DEC1	physical	23555304
BHE41_HUMAN	BHLHE41	physical	23555304
EZH2_HUMAN	EZH2	physical	23555304
FXL15_HUMAN	FBXL15	physical	23555304
GSK3B_HUMAN	GSK3B	physical	23555304
NPAS2_HUMAN	NPAS2	physical	23555304
PER1_HUMAN	PER1	physical	23555304
PER2_HUMAN	PER2	physical	23555304
PP1A_HUMAN	PPP1CA	physical	23555304
PP1B_HUMAN	PPP1CB	physical	23555304
PP1G_HUMAN	PPP1CC	physical	23555304
2AAA_HUMAN	PPP2R1A	physical	23555304
2AAB_HUMAN	PPP2R1B	physical	23555304
2A5D_HUMAN	PPP2R5D	physical	23555304
2A5E_HUMAN	PPP2R5E	physical	23555304
RORG_HUMAN	RORC	physical	23555304
NONO_HUMAN	NONO	physical	23555304
PP2AA_HUMAN	PPP2CA	physical	23555304
NFIL3_HUMAN	NFIL3	physical	23555304
NR1D2_HUMAN	NR1D2	physical	23555304

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DEC1_HUMAN

Related Literatures of Post-Translational Modification