FXL15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FXL15_HUMAN
• UniProt AC: Q9H469
• Protein Name: F-box/LRR-repeat protein 15
• Gene Name: FBXL15
• Organism: Homo sapiens (Human).
• Sequence Length: 300
• Subcellular Localization: Cytoplasm .
• Protein Description: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SMURF1, thereby acting as a positive regulator of the BMP signaling pathway. Required for dorsal/ventral pattern formation and bone mass maintenance. Also mediates ubiquitination of SMURF2 and WWP2..
• Protein Sequence: MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEPPMEPS -------CCCCCCCC	18.41	22814378
8	Phosphorylation	MEPPMEPSGGEQEPG CCCCCCCCCCCCCCC	46.23	-
180	Ubiquitination	LTACRQLKDEAIVYL HHHHHHCCHHHHHHH	45.22	-
262	Phosphorylation	CHHVAESSLSRLRKR CHHHHHHHHHHHHHC	23.13	27174698
264	Phosphorylation	HVAESSLSRLRKRGV HHHHHHHHHHHHCCC	31.08	27174698

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FXL15_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FXL15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FXL15_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMUF1_HUMAN	SMURF1	physical	21572392
CUL1_HUMAN	CUL1	physical	21572392
SKP1_HUMAN	SKP1	physical	21572392
RBX1_HUMAN	RBX1	physical	21572392
RORG_HUMAN	RORC	physical	23555304
SKP1_HUMAN	SKP1	physical	26186194
CUL1_HUMAN	CUL1	physical	26186194
ARI1_HUMAN	ARIH1	physical	26186194
SKP1_HUMAN	SKP1	physical	17463251
CUL1_HUMAN	CUL1	physical	28514442
SKP1_HUMAN	SKP1	physical	28514442
ARI1_HUMAN	ARIH1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.