| UniProt ID | SKP1_HUMAN | |
|---|---|---|
| UniProt AC | P63208 | |
| Protein Name | S-phase kinase-associated protein 1 | |
| Gene Name | SKP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 163 | |
| Subcellular Localization | ||
| Protein Description | Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. [PubMed: 25704143 SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2. SCF(FBXO10) directs ubiquitination of BCL2.] | |
| Protein Sequence | MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MPSIKLQSSD -----CCCEEEECCC | 30.93 | 3212432 | |
| 22 | Ubiquitination | EVDVEIAKQSVTIKT EEEHHHHHCCEEHHH | 49.09 | - | |
| 24 | Phosphorylation | DVEIAKQSVTIKTML EHHHHHCCEEHHHHH | 22.11 | 26074081 | |
| 26 | Phosphorylation | EIAKQSVTIKTMLED HHHHCCEEHHHHHHH | 23.23 | 26074081 | |
| 28 | Ubiquitination | AKQSVTIKTMLEDLG HHCCEEHHHHHHHCC | 20.65 | 29967540 | |
| 29 | Phosphorylation | KQSVTIKTMLEDLGM HCCEEHHHHHHHCCC | 24.12 | 26074081 | |
| 30 | Sulfoxidation | QSVTIKTMLEDLGMD CCEEHHHHHHHCCCC | 3.07 | 30846556 | |
| 36 | Sulfoxidation | TMLEDLGMDDEGDDD HHHHHCCCCCCCCCC | 8.36 | 30846556 | |
| 56 (in isoform 2) | Ubiquitination | - | 38.59 | 21890473 | |
| 56 (in isoform 1) | Ubiquitination | - | 38.59 | 21890473 | |
| 56 | Ubiquitination | NVNAAILKKVIQWCT CHHHHHHHHHHHHHH | 38.59 | 21906983 | |
| 57 | Ubiquitination | VNAAILKKVIQWCTH HHHHHHHHHHHHHHH | 40.92 | 22817900 | |
| 63 | Phosphorylation | KKVIQWCTHHKDDPP HHHHHHHHHCCCCCC | 24.85 | - | |
| 66 | Acetylation | IQWCTHHKDDPPPPE HHHHHHCCCCCCCCC | 57.11 | 26822725 | |
| 66 | Ubiquitination | IQWCTHHKDDPPPPE HHHHHHCCCCCCCCC | 57.11 | 29967540 | |
| 78 | Ubiquitination | PPEDDENKEKRTDDI CCCCCCCCCCCCCCC | 63.67 | 33845483 | |
| 80 | Ubiquitination | EDDENKEKRTDDIPV CCCCCCCCCCCCCCC | 63.31 | 29967540 | |
| 80 | Neddylation | EDDENKEKRTDDIPV CCCCCCCCCCCCCCC | 63.31 | 32015554 | |
| 121 | Ubiquitination | GLLDVTCKTVANMIK HHHHHHHHHHHHHHC | 36.35 | 32015554 | |
| 128 (in isoform 2) | Ubiquitination | - | 43.52 | 21890473 | |
| 128 (in isoform 1) | Ubiquitination | - | 43.52 | 21890473 | |
| 128 | Ubiquitination | KTVANMIKGKTPEEI HHHHHHHCCCCHHHH | 43.52 | 22817900 | |
| 128 | Acetylation | KTVANMIKGKTPEEI HHHHHHHCCCCHHHH | 43.52 | 25953088 | |
| 130 (in isoform 2) | Ubiquitination | - | 56.77 | 21890473 | |
| 130 (in isoform 1) | Ubiquitination | - | 56.77 | 21890473 | |
| 130 | Ubiquitination | VANMIKGKTPEEIRK HHHHHCCCCHHHHHH | 56.77 | 22817900 | |
| 131 | Phosphorylation | ANMIKGKTPEEIRKT HHHHCCCCHHHHHHH | 44.60 | 22167270 | |
| 131 (in isoform 2) | Phosphorylation | - | 44.60 | - | |
| 137 | Ubiquitination | KTPEEIRKTFNIKND CCHHHHHHHHCCCCC | 64.23 | 23000965 | |
| 137 (in isoform 1) | Ubiquitination | - | 64.23 | 21890473 | |
| 142 | Ubiquitination | IRKTFNIKNDFTEEE HHHHHCCCCCCCHHH | 52.12 | 23000965 | |
| 142 | Acetylation | IRKTFNIKNDFTEEE HHHHHCCCCCCCHHH | 52.12 | 26822725 | |
| 142 | Sumoylation | IRKTFNIKNDFTEEE HHHHHCCCCCCCHHH | 52.12 | 25114211 | |
| 142 (in isoform 1) | Ubiquitination | - | 52.12 | 21890473 | |
| 146 | Phosphorylation | FNIKNDFTEEEEAQV HCCCCCCCHHHHHHH | 45.40 | - | |
| 154 | Methylation | EEEEAQVRKENQWCE HHHHHHHHHHHHHHH | 28.61 | 115917037 | |
| 155 | Acetylation | EEEAQVRKENQWCEE HHHHHHHHHHHHHHC | 63.26 | 26051181 | |
| 155 | Ubiquitination | EEEAQVRKENQWCEE HHHHHHHHHHHHHHC | 63.26 | 33845483 | |
| 163 | Acetylation | ENQWCEEK------- HHHHHHCC------- | 43.26 | 90391 | |
| 163 | Ubiquitination | ENQWCEEK------- HHHHHHCC------- | 43.26 | 32015554 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKP1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
