UniProt ID | MCFD2_HUMAN | |
---|---|---|
UniProt AC | Q8NI22 | |
Protein Name | Multiple coagulation factor deficiency protein 2 | |
Gene Name | MCFD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 146 | |
Subcellular Localization | Endoplasmic reticulum-Golgi intermediate compartment . Endoplasmic reticulum . Golgi apparatus . | |
Protein Description | The MCFD2-LMAN1 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins. Plays a role in the secretion of coagulation factors.. | |
Protein Sequence | MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | O-linked_Glycosylation | RAEEPAASFSQPGSM CCCCCCCCCCCCCCC | 27.77 | OGP | |
34 | O-linked_Glycosylation | EEPAASFSQPGSMGL CCCCCCCCCCCCCCC | 32.73 | OGP | |
62 | Ubiquitination | HLEGVINKPEAEMSP HHHHHHCCCCHHCCH | 32.86 | - | |
68 | Phosphorylation | NKPEAEMSPQELQLH CCCCHHCCHHHHHHE | 18.22 | 26091039 | |
94 | O-linked_Glycosylation | LLDGLELSTAITHVH HHCCHHHHHHHHHHH | 13.35 | 55833649 | |
95 | O-linked_Glycosylation | LDGLELSTAITHVHK HCCHHHHHHHHHHHH | 34.40 | 55833655 | |
98 | O-linked_Glycosylation | LELSTAITHVHKEEG HHHHHHHHHHHHHCC | 18.51 | 55833659 | |
106 | Phosphorylation | HVHKEEGSEQAPLMS HHHHHCCCCCCCCCC | 29.80 | 29507054 | |
113 | Phosphorylation | SEQAPLMSEDELINI CCCCCCCCHHHHHHH | 49.97 | - | |
124 | Ubiquitination | LINIIDGVLRDDDKN HHHHHHHHCCCCCCC | 3.34 | 21890473 | |
130 | Ubiquitination | GVLRDDDKNNDGYID HHCCCCCCCCCCCCC | 65.72 | - | |
135 | Phosphorylation | DDKNNDGYIDYAEFA CCCCCCCCCCHHHHH | 8.09 | 22817900 | |
138 | Phosphorylation | NNDGYIDYAEFAKSL CCCCCCCHHHHHHHC | 9.85 | 30622161 | |
143 | Ubiquitination | IDYAEFAKSLQ---- CCHHHHHHHCC---- | 57.95 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCFD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCFD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCFD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LMAN1_HUMAN | LMAN1 | physical | 12717434 | |
A4_HUMAN | APP | physical | 21832049 | |
GDE_HUMAN | AGL | physical | 26344197 | |
CAPZB_HUMAN | CAPZB | physical | 26344197 | |
IF6_HUMAN | EIF6 | physical | 26344197 | |
ENOPH_HUMAN | ENOPH1 | physical | 26344197 | |
SYLC_HUMAN | LARS | physical | 26344197 | |
PSD12_HUMAN | PSMD12 | physical | 26344197 | |
PSMD6_HUMAN | PSMD6 | physical | 26344197 | |
RUVB2_HUMAN | RUVBL2 | physical | 26344197 | |
SYVC_HUMAN | VARS | physical | 26344197 |
loading...