UniProt ID | PSMD6_HUMAN | |
---|---|---|
UniProt AC | Q15008 | |
Protein Name | 26S proteasome non-ATPase regulatory subunit 6 | |
Gene Name | PSMD6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 389 | |
Subcellular Localization | ||
Protein Description | Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.. | |
Protein Sequence | MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Ubiquitination | LEEEGLPKNPDLRIA HHHCCCCCCCCCHHH | 82.95 | 24816145 | |
18 | Methylation | LPKNPDLRIAQLRFL CCCCCCCHHHHHHHH | 29.58 | 115489471 | |
42 | Sulfoxidation | AAVRDELMAAVRDNN HHHHHHHHHHHHCCC | 1.80 | 21406390 | |
43 | Ubiquitination | AVRDELMAAVRDNNM HHHHHHHHHHHCCCC | 18.54 | 29967540 | |
44 | Ubiquitination | VRDELMAAVRDNNMA HHHHHHHHHHCCCCH | 5.28 | 22817900 | |
48 | Ubiquitination | LMAAVRDNNMAPYYE HHHHHHCCCCHHHHH | 29.61 | 22817900 | |
54 | Ubiquitination | DNNMAPYYEALCKSL CCCCHHHHHHHHHHC | 8.15 | 21906983 | |
54 | Ubiquitination | DNNMAPYYEALCKSL CCCCHHHHHHHHHHC | 8.15 | 22817900 | |
55 | Ubiquitination | NNMAPYYEALCKSLD CCCHHHHHHHHHHCC | 29.35 | 22817900 | |
55 | Ubiquitination | NNMAPYYEALCKSLD CCCHHHHHHHHHHCC | 29.35 | 21890473 | |
58 | Ubiquitination | APYYEALCKSLDWQI HHHHHHHHHHCCCCC | 3.47 | 21963094 | |
59 | Ubiquitination | PYYEALCKSLDWQID HHHHHHHHHCCCCCC | 55.70 | 16196087 | |
60 | Phosphorylation | YYEALCKSLDWQIDV HHHHHHHHCCCCCCH | 30.48 | 28555341 | |
62 | Ubiquitination | EALCKSLDWQIDVDL HHHHHHCCCCCCHHH | 42.18 | 21963094 | |
65 (in isoform 4) | Phosphorylation | - | 4.93 | 25262027 | |
66 (in isoform 4) | Phosphorylation | - | 16.87 | 21815630 | |
68 | Ubiquitination | LDWQIDVDLLNKMKK CCCCCCHHHHHHHHH | 41.51 | 21906983 | |
68 | Ubiquitination | LDWQIDVDLLNKMKK CCCCCCHHHHHHHHH | 41.51 | 27667366 | |
68 (in isoform 4) | Phosphorylation | - | 41.51 | 25262027 | |
69 | Ubiquitination | DWQIDVDLLNKMKKA CCCCCHHHHHHHHHC | 5.96 | 21963094 | |
69 | Ubiquitination | DWQIDVDLLNKMKKA CCCCCHHHHHHHHHC | 5.96 | 21890473 | |
72 | Ubiquitination | IDVDLLNKMKKANED CCHHHHHHHHHCCHH | 52.66 | 24816145 | |
77 | Ubiquitination | LNKMKKANEDELKRL HHHHHHCCHHHHHHH | 67.16 | 22817900 | |
78 | Ubiquitination | NKMKKANEDELKRLD HHHHHCCHHHHHHHH | 58.69 | 33845483 | |
78 (in isoform 4) | Phosphorylation | - | 58.69 | 22210691 | |
79 | Ubiquitination | KMKKANEDELKRLDE HHHHCCHHHHHHHHH | 67.35 | 33845483 | |
81 | Ubiquitination | KKANEDELKRLDEEL HHCCHHHHHHHHHHH | 6.39 | 22817900 | |
82 | Ubiquitination | KANEDELKRLDEELE HCCHHHHHHHHHHHH | 49.20 | 29967540 | |
85 | Ubiquitination | EDELKRLDEELEDAE HHHHHHHHHHHHHHH | 51.89 | 22817900 | |
87 | Ubiquitination | ELKRLDEELEDAEKN HHHHHHHHHHHHHHH | 58.06 | 29967540 | |
88 | Ubiquitination | LKRLDEELEDAEKNL HHHHHHHHHHHHHHC | 7.31 | 29967540 | |
91 | Ubiquitination | LDEELEDAEKNLGES HHHHHHHHHHHCCHH | 21.93 | 21906983 | |
91 | Ubiquitination | LDEELEDAEKNLGES HHHHHHHHHHHCCHH | 21.93 | 22817900 | |
92 | Ubiquitination | DEELEDAEKNLGESE HHHHHHHHHHCCHHH | 55.59 | 22817900 | |
93 | Ubiquitination | EELEDAEKNLGESEI HHHHHHHHHCCHHHH | 60.23 | 21906983 | |
107 | Acetylation | IRDAMMAKAEYLCRI HHHHHHHHHHHHHHH | 24.69 | 27452117 | |
107 | Ubiquitination | IRDAMMAKAEYLCRI HHHHHHHHHHHHHHH | 24.69 | 21906983 | |
117 | Acetylation | YLCRIGDKEGALTAF HHHHHCCCCCCCHHH | 53.48 | 25953088 | |
117 | Ubiquitination | YLCRIGDKEGALTAF HHHHHCCCCCCCHHH | 53.48 | 27667366 | |
126 | Ubiquitination | GALTAFRKTYDKTVA CCCHHHHHCCCCHHH | 45.01 | 29967540 | |
127 | Ubiquitination | ALTAFRKTYDKTVAL CCHHHHHCCCCHHHH | 32.47 | 29967540 | |
130 | Acetylation | AFRKTYDKTVALGHR HHHHCCCCHHHHHHH | 34.19 | 27452117 | |
130 | Ubiquitination | AFRKTYDKTVALGHR HHHHCCCCHHHHHHH | 34.19 | 22817900 | |
135 | Ubiquitination | YDKTVALGHRLDIVF CCCHHHHHHHHHHHH | 8.30 | 29967540 | |
146 | Ubiquitination | DIVFYLLRIGLFYMD HHHHHHHHHHHHHCC | 20.52 | 22817900 | |
152 | Sulfoxidation | LRIGLFYMDNDLITR HHHHHHHCCCCCCCC | 2.80 | 21406390 | |
160 | Ubiquitination | DNDLITRNTEKAKSL CCCCCCCCHHHHHHH | 43.89 | 21963094 | |
165 | 2-Hydroxyisobutyrylation | TRNTEKAKSLIEEGG CCCHHHHHHHHHCCC | 57.79 | - | |
165 | Acetylation | TRNTEKAKSLIEEGG CCCHHHHHHHHHCCC | 57.79 | 27452117 | |
165 | Ubiquitination | TRNTEKAKSLIEEGG CCCHHHHHHHHHCCC | 57.79 | 29967540 | |
166 | Phosphorylation | RNTEKAKSLIEEGGD CCHHHHHHHHHCCCC | 39.16 | 23312004 | |
170 | Ubiquitination | KAKSLIEEGGDWDRR HHHHHHHCCCCCCHH | 62.58 | 33845483 | |
179 | Ubiquitination | GDWDRRNRLKVYQGL CCCCHHHHHHHHCCH | 33.79 | 29967540 | |
181 | Ubiquitination | WDRRNRLKVYQGLYC CCHHHHHHHHCCHHH | 35.34 | - | |
183 | Ubiquitination | RRNRLKVYQGLYCVA HHHHHHHHCCHHHEE | 8.69 | 22817900 | |
187 | Phosphorylation | LKVYQGLYCVAIRDF HHHHCCHHHEEHHCH | 7.54 | 28152594 | |
190 | Ubiquitination | YQGLYCVAIRDFKQA HCCHHHEEHHCHHHH | 6.37 | 22817900 | |
193 | Ubiquitination | LYCVAIRDFKQAAEL HHHEEHHCHHHHHHH | 49.32 | 21963094 | |
194 | Ubiquitination | YCVAIRDFKQAAELF HHEEHHCHHHHHHHH | 4.54 | 22817900 | |
197 | Ubiquitination | AIRDFKQAAELFLDT EHHCHHHHHHHHHHH | 11.95 | 21963094 | |
200 | Ubiquitination | DFKQAAELFLDTVST CHHHHHHHHHHHHHH | 4.41 | 22817900 | |
201 | Ubiquitination | FKQAAELFLDTVSTF HHHHHHHHHHHHHHC | 4.34 | 22817900 | |
203 | Ubiquitination | QAAELFLDTVSTFTS HHHHHHHHHHHHCCC | 37.41 | 21906983 | |
203 | Ubiquitination | QAAELFLDTVSTFTS HHHHHHHHHHHHCCC | 37.41 | 21963094 | |
204 | Ubiquitination | AAELFLDTVSTFTSY HHHHHHHHHHHCCCH | 20.64 | 21963094 | |
216 | Phosphorylation | TSYELMDYKTFVTYT CCHHCCCCCHHEEEH | 9.65 | 20860994 | |
218 | Ubiquitination | YELMDYKTFVTYTVY HHCCCCCHHEEEHHH | 19.67 | 29967540 | |
222 | Phosphorylation | DYKTFVTYTVYVSMI CCCHHEEEHHHHHHH | 6.73 | 20860994 | |
225 | Phosphorylation | TFVTYTVYVSMIALE HHEEEHHHHHHHHHC | 4.49 | 23911959 | |
227 | Phosphorylation | VTYTVYVSMIALERP EEEHHHHHHHHHCCC | 6.18 | 23911959 | |
234 | Ubiquitination | SMIALERPDLREKVI HHHHHCCCCHHHHHH | 35.30 | 16196087 | |
235 | Ubiquitination | MIALERPDLREKVIK HHHHCCCCHHHHHHC | 65.66 | 16196087 | |
238 | Ubiquitination | LERPDLREKVIKGAE HCCCCHHHHHHCHHH | 60.00 | 16196087 | |
239 | Ubiquitination | ERPDLREKVIKGAEI CCCCHHHHHHCHHHH | 42.71 | 22817900 | |
242 | Ubiquitination | DLREKVIKGAEILEV CHHHHHHCHHHHHHH | 55.87 | 21906983 | |
244 | Ubiquitination | REKVIKGAEILEVLH HHHHHCHHHHHHHHH | 8.82 | 16196087 | |
245 | Ubiquitination | EKVIKGAEILEVLHS HHHHCHHHHHHHHHC | 57.69 | 16196087 | |
246 | Ubiquitination | KVIKGAEILEVLHSL HHHCHHHHHHHHHCC | 3.84 | 16196087 | |
252 | Phosphorylation | EILEVLHSLPAVRQY HHHHHHHCCHHHHHH | 31.71 | 21601212 | |
283 | Ubiquitination | AVVEQEMKKDWLFAP HHHHHHHCCCCCCCC | 46.99 | 16196087 | |
284 | Acetylation | VVEQEMKKDWLFAPH HHHHHHCCCCCCCCH | 53.48 | 26051181 | |
284 | Ubiquitination | VVEQEMKKDWLFAPH HHHHHHCCCCCCCCH | 53.48 | 16196087 | |
292 | Ubiquitination | DWLFAPHYRYYVREM CCCCCCHHHHHHHHH | 10.15 | 22817900 | |
295 | Ubiquitination | FAPHYRYYVREMRIH CCCHHHHHHHHHHHH | 5.52 | 21963094 | |
297 | Ubiquitination | PHYRYYVREMRIHAY CHHHHHHHHHHHHHH | 18.84 | 21963094 | |
300 | Ubiquitination | RYYVREMRIHAYSQL HHHHHHHHHHHHHHH | 16.88 | 22817900 | |
301 | Ubiquitination | YYVREMRIHAYSQLL HHHHHHHHHHHHHHH | 1.79 | 21963094 | |
304 | Ubiquitination | REMRIHAYSQLLESY HHHHHHHHHHHHHHH | 5.25 | 22817900 | |
307 | Ubiquitination | RIHAYSQLLESYRSL HHHHHHHHHHHHHHC | 4.75 | 21963094 | |
308 | Ubiquitination | IHAYSQLLESYRSLT HHHHHHHHHHHHHCH | 2.97 | 21963094 | |
310 | Ubiquitination | AYSQLLESYRSLTLG HHHHHHHHHHHCHHH | 26.30 | 21906983 | |
310 | Ubiquitination | AYSQLLESYRSLTLG HHHHHHHHHHHCHHH | 26.30 | 22817900 | |
311 | Ubiquitination | YSQLLESYRSLTLGY HHHHHHHHHHCHHHH | 8.54 | 22817900 | |
313 | Ubiquitination | QLLESYRSLTLGYMA HHHHHHHHCHHHHHH | 19.92 | 27667366 | |
317 | Ubiquitination | SYRSLTLGYMAEAFG HHHHCHHHHHHHHHC | 12.63 | 27667366 | |
322 | Ubiquitination | TLGYMAEAFGVGVEF HHHHHHHHHCCCHHH | 9.28 | 22817900 | |
323 | Ubiquitination | LGYMAEAFGVGVEFI HHHHHHHHCCCHHHH | 6.49 | 21906983 | |
323 | Ubiquitination | LGYMAEAFGVGVEFI HHHHHHHHCCCHHHH | 6.49 | 27667366 | |
324 | Ubiquitination | GYMAEAFGVGVEFID HHHHHHHCCCHHHHC | 23.47 | 27667366 | |
324 | Ubiquitination | GYMAEAFGVGVEFID HHHHHHHCCCHHHHC | 23.47 | 21890473 | |
326 | Ubiquitination | MAEAFGVGVEFIDQE HHHHHCCCHHHHCHH | 17.39 | 22817900 | |
327 | Ubiquitination | AEAFGVGVEFIDQEL HHHHCCCHHHHCHHH | 5.15 | 22817900 | |
332 | Ubiquitination | VGVEFIDQELSRFIA CCHHHHCHHHHHHHH | 49.03 | 21906983 | |
332 | Ubiquitination | VGVEFIDQELSRFIA CCHHHHCHHHHHHHH | 49.03 | 27667366 | |
333 | Ubiquitination | GVEFIDQELSRFIAA CHHHHCHHHHHHHHH | 44.99 | 21906983 | |
333 | Ubiquitination | GVEFIDQELSRFIAA CHHHHCHHHHHHHHH | 44.99 | 27667366 | |
334 | Ubiquitination | VEFIDQELSRFIAAG HHHHCHHHHHHHHHC | 3.56 | 27667366 | |
336 | Ubiquitination | FIDQELSRFIAAGRL HHCHHHHHHHHHCCC | 39.35 | 16196087 | |
337 | Ubiquitination | IDQELSRFIAAGRLH HCHHHHHHHHHCCCC | 3.91 | 16196087 | |
343 | Ubiquitination | RFIAAGRLHCKIDKV HHHHHCCCCCCHHHH | 5.64 | 27667366 | |
344 | Ubiquitination | FIAAGRLHCKIDKVN HHHHCCCCCCHHHHH | 14.95 | 27667366 | |
346 | Ubiquitination | AAGRLHCKIDKVNEI HHCCCCCCHHHHHHH | 43.10 | 21963094 | |
349 | Acetylation | RLHCKIDKVNEIVET CCCCCHHHHHHHHHH | 50.89 | 25953088 | |
349 | Ubiquitination | RLHCKIDKVNEIVET CCCCCHHHHHHHHHH | 50.89 | 21906983 | |
356 | Phosphorylation | KVNEIVETNRPDSKN HHHHHHHHCCCCCCC | 26.15 | 27732954 | |
361 | Phosphorylation | VETNRPDSKNWQYQE HHHCCCCCCCCCHHH | 30.48 | 25849741 | |
362 | Ubiquitination | ETNRPDSKNWQYQET HHCCCCCCCCCHHHH | 70.37 | 21890473 | |
362 | Ubiquitination | ETNRPDSKNWQYQET HHCCCCCCCCCHHHH | 70.37 | 27667366 | |
366 | Phosphorylation | PDSKNWQYQETIKKG CCCCCCCHHHHHHHC | 10.42 | 28796482 | |
369 | Phosphorylation | KNWQYQETIKKGDLL CCCCHHHHHHHCHHH | 23.67 | 28796482 | |
371 | Ubiquitination | WQYQETIKKGDLLLN CCHHHHHHHCHHHHH | 59.11 | 21906983 | |
372 | Ubiquitination | QYQETIKKGDLLLNR CHHHHHHHCHHHHHH | 54.53 | 21906983 | |
379 | Methylation | KGDLLLNRVQKLSRV HCHHHHHHHHHHHHH | 32.01 | 115489465 | |
382 | Ubiquitination | LLLNRVQKLSRVINM HHHHHHHHHHHHHCC | 45.64 | 27667366 | |
384 | Phosphorylation | LNRVQKLSRVINM-- HHHHHHHHHHHCC-- | 31.38 | 24719451 | |
399 | Ubiquitination | ----------------- ----------------- | 21963094 | ||
402 | Ubiquitination | -------------------- -------------------- | 22817900 | ||
415 | Ubiquitination | --------------------------------- --------------------------------- | 27667366 | ||
424 | Ubiquitination | ------------------------------------------ ------------------------------------------ | 27667366 | ||
425 | Ubiquitination | ------------------------------------------- ------------------------------------------- | 27667366 | ||
435 | Ubiquitination | ----------------------------------------------------- ----------------------------------------------------- | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMD6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMD6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMD6_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...