| UniProt ID | PSA3_HUMAN | |
|---|---|---|
| UniProt AC | P25788 | |
| Protein Name | Proteasome subunit alpha type-3 | |
| Gene Name | PSMA3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 255 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.. | |
| Protein Sequence | MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSSIGTGYD ------CCCCCCCCC | 30.57 | 12376572 | |
| 2 | Phosphorylation | ------MSSIGTGYD ------CCCCCCCCC | 30.57 | 28464451 | |
| 2 (in isoform 2) | Acetylation | - | 30.57 | - | |
| 3 | Phosphorylation | -----MSSIGTGYDL -----CCCCCCCCCC | 24.60 | 30576142 | |
| 6 | Phosphorylation | --MSSIGTGYDLSAS --CCCCCCCCCCCCC | 30.79 | 26074081 | |
| 8 | Nitration | MSSIGTGYDLSASTF CCCCCCCCCCCCCEE | 17.35 | - | |
| 8 | Phosphorylation | MSSIGTGYDLSASTF CCCCCCCCCCCCCEE | 17.35 | 26074081 | |
| 8 (in isoform 2) | Phosphorylation | - | 17.35 | - | |
| 11 | Phosphorylation | IGTGYDLSASTFSPD CCCCCCCCCCEECCC | 19.78 | 20068231 | |
| 13 | Phosphorylation | TGYDLSASTFSPDGR CCCCCCCCEECCCCC | 26.98 | 25159151 | |
| 14 | Phosphorylation | GYDLSASTFSPDGRV CCCCCCCEECCCCCE | 28.05 | 22199227 | |
| 16 | Phosphorylation | DLSASTFSPDGRVFQ CCCCCEECCCCCEEE | 23.36 | 25159151 | |
| 16 (in isoform 2) | Phosphorylation | - | 23.36 | - | |
| 26 | Phosphorylation | GRVFQVEYAMKAVEN CCEEEEEEHHHHHHC | 17.09 | 26074081 | |
| 28 | Sulfoxidation | VFQVEYAMKAVENSS EEEEEEHHHHHHCCC | 2.54 | 21406390 | |
| 29 | Ubiquitination | FQVEYAMKAVENSST EEEEEHHHHHHCCCC | 40.90 | 21906983 | |
| 29 (in isoform 1) | Ubiquitination | - | 40.90 | 21890473 | |
| 29 (in isoform 2) | Ubiquitination | - | 40.90 | 21890473 | |
| 34 | Phosphorylation | AMKAVENSSTAIGIR HHHHHHCCCCEEEEE | 18.63 | 26074081 | |
| 35 | Phosphorylation | MKAVENSSTAIGIRC HHHHHCCCCEEEEEE | 33.18 | 26074081 | |
| 36 | Phosphorylation | KAVENSSTAIGIRCK HHHHCCCCEEEEEEC | 23.32 | 21712546 | |
| 43 | Acetylation | TAIGIRCKDGVVFGV CEEEEEECCCEEEEE | 47.90 | 26051181 | |
| 43 | Ubiquitination | TAIGIRCKDGVVFGV CEEEEEECCCEEEEE | 47.90 | 21906983 | |
| 43 (in isoform 1) | Ubiquitination | - | 47.90 | 21890473 | |
| 43 (in isoform 2) | Ubiquitination | - | 47.90 | 21890473 | |
| 52 | 2-Hydroxyisobutyrylation | GVVFGVEKLVLSKLY CEEEEEEHHHHHHHH | 41.30 | - | |
| 52 | Ubiquitination | GVVFGVEKLVLSKLY CEEEEEEHHHHHHHH | 41.30 | - | |
| 57 | Ubiquitination | VEKLVLSKLYEEGSN EEHHHHHHHHHCCCC | 51.43 | 21890473 | |
| 57 | 2-Hydroxyisobutyrylation | VEKLVLSKLYEEGSN EEHHHHHHHHHCCCC | 51.43 | - | |
| 57 | Acetylation | VEKLVLSKLYEEGSN EEHHHHHHHHHCCCC | 51.43 | 19608861 | |
| 57 | Malonylation | VEKLVLSKLYEEGSN EEHHHHHHHHHCCCC | 51.43 | 26320211 | |
| 57 | Ubiquitination | VEKLVLSKLYEEGSN EEHHHHHHHHHCCCC | 51.43 | 21890473 | |
| 57 (in isoform 1) | Ubiquitination | - | 51.43 | 21890473 | |
| 57 (in isoform 2) | Acetylation | - | 51.43 | - | |
| 57 (in isoform 2) | Ubiquitination | - | 51.43 | 21890473 | |
| 59 | Phosphorylation | KLVLSKLYEEGSNKR HHHHHHHHHCCCCCC | 18.70 | 28152594 | |
| 65 | 2-Hydroxyisobutyrylation | LYEEGSNKRLFNVDR HHHCCCCCCCCEECH | 52.77 | - | |
| 65 | Acetylation | LYEEGSNKRLFNVDR HHHCCCCCCCCEECH | 52.77 | 23749302 | |
| 65 | Ubiquitination | LYEEGSNKRLFNVDR HHHCCCCCCCCEECH | 52.77 | 21906983 | |
| 65 (in isoform 1) | Ubiquitination | - | 52.77 | 21890473 | |
| 65 (in isoform 2) | Ubiquitination | - | 52.77 | 21890473 | |
| 97 | Phosphorylation | DIAREEASNFRSNFG HHHHHHHHHHHHCCC | 39.52 | - | |
| 101 | Phosphorylation | EEASNFRSNFGYNIP HHHHHHHHCCCCCCC | 32.16 | 21712546 | |
| 105 | Phosphorylation | NFRSNFGYNIPLKHL HHHHCCCCCCCHHHH | 13.04 | 20090780 | |
| 110 | Ubiquitination | FGYNIPLKHLADRVA CCCCCCHHHHHHHHH | 31.08 | 21890473 | |
| 110 | Acetylation | FGYNIPLKHLADRVA CCCCCCHHHHHHHHH | 31.08 | 19608861 | |
| 110 | Ubiquitination | FGYNIPLKHLADRVA CCCCCCHHHHHHHHH | 31.08 | 21890473 | |
| 110 (in isoform 1) | Ubiquitination | - | 31.08 | 21890473 | |
| 110 (in isoform 2) | Acetylation | - | 31.08 | - | |
| 110 (in isoform 2) | Ubiquitination | - | 31.08 | 21890473 | |
| 154 (in isoform 2) | Phosphorylation | - | 23.27 | - | |
| 161 | Phosphorylation | PSGVSYGYWGCAIGK CCCCCCCCHHHHHHH | 7.15 | 22817900 | |
| 172 (in isoform 2) | Ubiquitination | - | 12.84 | 21890473 | |
| 174 | Ubiquitination | GKARQAAKTEIEKLQ HHHHHHHHHHHHHHH | 50.10 | - | |
| 175 | Phosphorylation | KARQAAKTEIEKLQM HHHHHHHHHHHHHHH | 37.15 | 28258704 | |
| 176 (in isoform 2) | Ubiquitination | - | 48.74 | 21890473 | |
| 179 | 2-Hydroxyisobutyrylation | AAKTEIEKLQMKEMT HHHHHHHHHHHHHCC | 50.08 | - | |
| 179 | Acetylation | AAKTEIEKLQMKEMT HHHHHHHHHHHHHCC | 50.08 | 26822725 | |
| 179 | Ubiquitination | AAKTEIEKLQMKEMT HHHHHHHHHHHHHCC | 50.08 | 21906983 | |
| 179 (in isoform 1) | Ubiquitination | - | 50.08 | 21890473 | |
| 183 | Acetylation | EIEKLQMKEMTCRDI HHHHHHHHHCCHHHH | 31.22 | 25953088 | |
| 183 | Ubiquitination | EIEKLQMKEMTCRDI HHHHHHHHHCCHHHH | 31.22 | 21906983 | |
| 183 (in isoform 1) | Ubiquitination | - | 31.22 | 21890473 | |
| 186 | Phosphorylation | KLQMKEMTCRDIVKE HHHHHHCCHHHHHHH | 12.89 | 28258704 | |
| 192 | Acetylation | MTCRDIVKEVAKIIY CCHHHHHHHHHHHHE | 46.97 | 25953088 | |
| 192 | Ubiquitination | MTCRDIVKEVAKIIY CCHHHHHHHHHHHHE | 46.97 | - | |
| 199 | Acetylation | KEVAKIIYIVHDEVK HHHHHHHEEECHHHC | 10.60 | 19608861 | |
| 199 | Phosphorylation | KEVAKIIYIVHDEVK HHHHHHHEEECHHHC | 10.60 | 28152594 | |
| 199 | Ubiquitination | KEVAKIIYIVHDEVK HHHHHHHEEECHHHC | 10.60 | 19608861 | |
| 199 (in isoform 2) | Acetylation | - | 10.60 | - | |
| 199 (in isoform 2) | Ubiquitination | - | 10.60 | 21890473 | |
| 206 | 2-Hydroxyisobutyrylation | YIVHDEVKDKAFELE EEECHHHCCCCEEEE | 52.01 | - | |
| 206 | Acetylation | YIVHDEVKDKAFELE EEECHHHCCCCEEEE | 52.01 | 19608861 | |
| 206 | Ubiquitination | YIVHDEVKDKAFELE EEECHHHCCCCEEEE | 52.01 | 21906983 | |
| 206 (in isoform 1) | Ubiquitination | - | 52.01 | 21890473 | |
| 208 | Ubiquitination | VHDEVKDKAFELELS ECHHHCCCCEEEEEE | 49.62 | - | |
| 223 | Acetylation | WVGELTNGRHEIVPK EEEECCCCCCEECCH | 27.38 | 19608861 | |
| 223 | Ubiquitination | WVGELTNGRHEIVPK EEEECCCCCCEECCH | 27.38 | 19608861 | |
| 223 (in isoform 2) | Acetylation | - | 27.38 | - | |
| 223 (in isoform 2) | Ubiquitination | - | 27.38 | 21890473 | |
| 230 | Ubiquitination | GRHEIVPKDIREEAE CCCEECCHHHHHHHH | 55.69 | 21890473 | |
| 230 | 2-Hydroxyisobutyrylation | GRHEIVPKDIREEAE CCCEECCHHHHHHHH | 55.69 | - | |
| 230 | Acetylation | GRHEIVPKDIREEAE CCCEECCHHHHHHHH | 55.69 | 19608861 | |
| 230 | Ubiquitination | GRHEIVPKDIREEAE CCCEECCHHHHHHHH | 55.69 | 21890473 | |
| 230 (in isoform 1) | Ubiquitination | - | 55.69 | 21890473 | |
| 231 | Acetylation | RHEIVPKDIREEAEK CCEECCHHHHHHHHH | 38.82 | 19608861 | |
| 231 | Ubiquitination | RHEIVPKDIREEAEK CCEECCHHHHHHHHH | 38.82 | 19608861 | |
| 231 (in isoform 2) | Acetylation | - | 38.82 | - | |
| 231 (in isoform 2) | Ubiquitination | - | 38.82 | 21890473 | |
| 236 (in isoform 2) | Phosphorylation | - | 17.52 | - | |
| 238 | Ubiquitination | DIREEAEKYAKESLK HHHHHHHHHHHHHHH | 58.52 | 21890473 | |
| 238 | Acetylation | DIREEAEKYAKESLK HHHHHHHHHHHHHHH | 58.52 | 23749302 | |
| 238 | Ubiquitination | DIREEAEKYAKESLK HHHHHHHHHHHHHHH | 58.52 | 21890473 | |
| 238 (in isoform 1) | Ubiquitination | - | 58.52 | 21890473 | |
| 238 (in isoform 2) | Ubiquitination | - | 58.52 | 21890473 | |
| 241 | Ubiquitination | EEAEKYAKESLKEED HHHHHHHHHHHHHCC | 44.75 | - | |
| 243 | Phosphorylation | AEKYAKESLKEEDES HHHHHHHHHHHCCCC | 43.99 | 19664994 | |
| 243 (in isoform 2) | Phosphorylation | - | 43.99 | - | |
| 245 | Ubiquitination | KYAKESLKEEDESDD HHHHHHHHHCCCCCC | 69.23 | 2190698 | |
| 245 (in isoform 1) | Ubiquitination | - | 69.23 | 21890473 | |
| 250 | Phosphorylation | SLKEEDESDDDNM-- HHHHCCCCCCCCC-- | 59.67 | 19664994 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 243 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
| 243 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
| 250 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
| 250 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSA3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSA3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Mass spectrometric characterization of the affinity-purified human26S proteasome complex."; Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.; Biochemistry 46:3553-3565(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, ACETYLATION ATSER-2, AND MASS SPECTROMETRY. | |
| "Mapping and structural dissection of human 20 s proteasome usingproteomic approaches."; Claverol S., Burlet-Schiltz O., Girbal-Neuhauser E., Gairin J.E.,Monsarrat B.; Mol. Cell. Proteomics 1:567-578(2002). Cited for: ACETYLATION AT SER-2, AND PHOSPHORYLATION AT SER-250. | |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-57; LYS-110; LYS-206;LYS-230 AND LYS-238, AND MASS SPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Large-scale phosphoproteome analysis of human liver tissue byenrichment and fractionation of phosphopeptides with strong anionexchange chromatography."; Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D.,Zou H., Gu J.; Proteomics 8:1346-1361(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Phosphorylation analysis of primary human T lymphocytes usingsequential IMAC and titanium oxide enrichment."; Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.; J. Proteome Res. 7:5167-5176(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry."; Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.; Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-243 AND SER-250, ANDMASS SPECTROMETRY. | |
| "Toward a global characterization of the phosphoproteome in prostatecancer cells: identification of phosphoproteins in the LNCaP cellline."; Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S.; Electrophoresis 28:2027-2034(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Mass spectrometric characterization of the affinity-purified human26S proteasome complex."; Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.; Biochemistry 46:3553-3565(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, ACETYLATION ATSER-2, AND MASS SPECTROMETRY. | |
| "A probability-based approach for high-throughput proteinphosphorylation analysis and site localization."; Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.; Nat. Biotechnol. 24:1285-1292(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Large-scale characterization of HeLa cell nuclear phosphoproteins."; Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J.,Li J., Cohn M.A., Cantley L.C., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250, AND MASSSPECTROMETRY. | |
| "Mapping and structural dissection of human 20 s proteasome usingproteomic approaches."; Claverol S., Burlet-Schiltz O., Girbal-Neuhauser E., Gairin J.E.,Monsarrat B.; Mol. Cell. Proteomics 1:567-578(2002). Cited for: ACETYLATION AT SER-2, AND PHOSPHORYLATION AT SER-250. | |
| "Immunoaffinity profiling of tyrosine phosphorylation in cancercells."; Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.; Nat. Biotechnol. 23:94-101(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-161, AND MASSSPECTROMETRY. | |
