UniProt ID | CCL28_HUMAN | |
---|---|---|
UniProt AC | Q9NRJ3 | |
Protein Name | C-C motif chemokine 28 | |
Gene Name | CCL28 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 127 | |
Subcellular Localization | Secreted. | |
Protein Description | Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.. | |
Protein Sequence | MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
78 | N-linked_Glycosylation | RICVSPHNHTVKQWM CEEECCCCHHHHHHH | 35.59 | UniProtKB CARBOHYD | |
92 | Acetylation | MKVQAAKKNGKGNVC HHHHHHHHCCCCCCC | 67.23 | 18586027 | |
95 | Acetylation | QAAKKNGKGNVCHRK HHHHHCCCCCCCCCC | 57.62 | 18586035 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCL28_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCL28_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCL28_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DDI1_HUMAN | DDI1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...