UniProt ID | SPAT8_HUMAN | |
---|---|---|
UniProt AC | Q6RVD6 | |
Protein Name | Spermatogenesis-associated protein 8 | |
Gene Name | SPATA8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 105 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAPAGMSGAQDNSCLYQEIAPSFQRLPCPRTSSRHFSEAMTCPCGWRPFKGGPGGLKGPVWPAKEENSCSHGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPAT8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPAT8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPAT8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
FHL3_HUMAN | FHL3 | physical | 21516116 | |
PSMG2_HUMAN | PSMG2 | physical | 28514442 | |
PSMG3_HUMAN | PSMG3 | physical | 28514442 | |
PSMG1_HUMAN | PSMG1 | physical | 28514442 | |
RUSD2_HUMAN | RPUSD2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...