| UniProt ID | SPAT8_HUMAN | |
|---|---|---|
| UniProt AC | Q6RVD6 | |
| Protein Name | Spermatogenesis-associated protein 8 | |
| Gene Name | SPATA8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 105 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAPAGMSGAQDNSCLYQEIAPSFQRLPCPRTSSRHFSEAMTCPCGWRPFKGGPGGLKGPVWPAKEENSCSHGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPAT8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPAT8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPAT8_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
| FHL3_HUMAN | FHL3 | physical | 21516116 | |
| PSMG2_HUMAN | PSMG2 | physical | 28514442 | |
| PSMG3_HUMAN | PSMG3 | physical | 28514442 | |
| PSMG1_HUMAN | PSMG1 | physical | 28514442 | |
| RUSD2_HUMAN | RPUSD2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...