UniProt ID | FHL3_HUMAN | |
---|---|---|
UniProt AC | Q13643 | |
Protein Name | Four and a half LIM domains protein 3 | |
Gene Name | FHL3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 280 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSESFDCAK ------CCCCCCCCC | 41.78 | 22814378 | |
2 | Phosphorylation | ------MSESFDCAK ------CCCCCCCCC | 41.78 | 27251275 | |
9 | Sumoylation | SESFDCAKCNESLYG CCCCCCCCCCHHHCC | 43.88 | - | |
9 | Sumoylation | SESFDCAKCNESLYG CCCCCCCCCCHHHCC | 43.88 | - | |
13 | Phosphorylation | DCAKCNESLYGRKYI CCCCCCHHHCCCCEE | 16.95 | 27251275 | |
140 | Phosphorylation | EQPLGSRSFVPDKGA CCCCCCCCCCCCCCC | 32.09 | 26437602 | |
145 | Ubiquitination | SRSFVPDKGAHYCVP CCCCCCCCCCCEEEE | 52.51 | - | |
149 | Phosphorylation | VPDKGAHYCVPCYEN CCCCCCCEEEECCCC | 8.46 | 25159151 | |
157 | Sumoylation | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | - | |
157 | Ubiquitination | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | - | |
157 | Sumoylation | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | - | |
157 | Acetylation | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | - | |
167 | Sumoylation | PRCARCSKTLTQGGV HHHHHCCCEEEECCC | 51.70 | - | |
167 | Ubiquitination | PRCARCSKTLTQGGV HHHHHCCCEEEECCC | 51.70 | 21890473 | |
167 | Sumoylation | PRCARCSKTLTQGGV HHHHHCCCEEEECCC | 51.70 | - | |
168 | O-linked_Glycosylation | RCARCSKTLTQGGVT HHHHCCCEEEECCCC | 20.81 | 30379171 | |
170 | Phosphorylation | ARCSKTLTQGGVTYR HHCCCEEEECCCCCC | 30.33 | 28555341 | |
189 | Phosphorylation | HRECLVCTGCQTPLA CCEEEEECCCCCCCC | 33.25 | 28165663 | |
193 | Phosphorylation | LVCTGCQTPLAGQQF EEECCCCCCCCCCCC | 25.09 | 25159151 | |
235 | Acetylation | IVGLGGGKYVSFEDR EEEECCCCEEECCCC | 45.84 | 25953088 | |
235 | Ubiquitination | IVGLGGGKYVSFEDR EEEECCCCEEECCCC | 45.84 | 21890473 | |
236 | Phosphorylation | VGLGGGKYVSFEDRH EEECCCCEEECCCCC | 12.47 | 26437602 | |
238 | Phosphorylation | LGGGKYVSFEDRHWH ECCCCEEECCCCCCC | 21.59 | 21815630 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FHL3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FHL3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FHL3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...