UniProt ID | SRGN_HUMAN | |
---|---|---|
UniProt AC | P10124 | |
Protein Name | Serglycin | |
Gene Name | SRGN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization | Cytoplasmic granule . Secreted, extracellular space . Golgi apparatus . Found in mast cell granules and in cytoplasmic granules of cytolytic T lymphocytes from where it is secreted upon cell activation (By similarity). Secreted constitutively by endo | |
Protein Description | Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.. | |
Protein Sequence | MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | MQKLLKCSRLVLALA HHHHHHHHHHHHHHH | 27.36 | 24719451 | |
23 | Phosphorylation | ALILVLESSVQGYPT HHHHHHHHHHCCCCC | 31.48 | 24719451 | |
28 | Phosphorylation | LESSVQGYPTRRARY HHHHHCCCCCCCCCE | 5.59 | 24719451 | |
64 | Phosphorylation | FELLPGESNKIPRLR EEECCCCCCCCCCCC | 49.71 | 28060719 | |
94 | O-linked_Glycosylation | FPLSEDYSGSGFGSG CCCCCCCCCCCCCCC | 38.51 | 3402609 | |
96 | O-linked_Glycosylation | LSEDYSGSGFGSGSG CCCCCCCCCCCCCCC | 25.63 | 3402609 | |
100 | O-linked_Glycosylation | YSGSGFGSGSGSGSG CCCCCCCCCCCCCCC | 27.76 | - | |
102 | O-linked_Glycosylation | GSGFGSGSGSGSGSG CCCCCCCCCCCCCCC | 31.33 | - | |
104 | O-linked_Glycosylation | GFGSGSGSGSGSGSG CCCCCCCCCCCCCCC | 31.33 | - | |
106 | O-linked_Glycosylation | GSGSGSGSGSGSGFL CCCCCCCCCCCCCCC | 31.33 | - | |
108 | O-linked_Glycosylation | GSGSGSGSGSGFLTE CCCCCCCCCCCCCHH | 31.33 | - | |
110 | O-linked_Glycosylation | GSGSGSGSGFLTEME CCCCCCCCCCCHHHH | 28.24 | - | |
142 | Phosphorylation | SLDRNLPSDSQDLGQ HHHHCCCCCCCCHHH | 53.73 | 23532336 | |
144 | Phosphorylation | DRNLPSDSQDLGQHG HHCCCCCCCCHHHCC | 29.90 | 28450419 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRGN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRGN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRGN_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SGTA_HUMAN | SGTA | physical | 16189514 | |
PSRC1_HUMAN | PSRC1 | physical | 21900206 | |
BAG6_HUMAN | BAG6 | physical | 21900206 | |
CEP70_HUMAN | CEP70 | physical | 21900206 | |
UBR4_HUMAN | UBR4 | physical | 21900206 | |
SGTA_HUMAN | SGTA | physical | 25416956 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
O-linked Glycosylation | |
Reference | PubMed |
"Complete amino acid sequence of a human platelet proteoglycan."; Alliel P.M., Perin J.-P., Maillet P., Bonnet F., Rosa J.-P.,Jolles P.; FEBS Lett. 236:123-126(1988). Cited for: PROTEIN SEQUENCE OF 28-158, NUCLEOTIDE SEQUENCE [MRNA] OF 34-158, ANDGLYCOSYLATION AT SER-94 AND SER-96. |