dbPTM

KR122_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KR122_HUMAN
UniProt AC	P59991
Protein Name	Keratin-associated protein 12-2
Gene Name	KRTAP12-2
Organism	Homo sapiens (Human).
Sequence Length	146
Subcellular Localization
Protein Description	In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
Protein Sequence	MCHTSCSSGCQPACCAPSPCQPACCVPSSCQASCCVPVGCQSSVCVPVSFKPAVCLPVSCQSSVCVPMSFKSAVCVPVSCQSSVCVPVSCRPIVCAAPSCQSSLCVPVSCRPVVYAAPSCQSSGCCQPSCTSVLCRPISYSISSCC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
99	Phosphorylation	PIVCAAPSCQSSLCV EEEEECCCCCCCCEE	21.77	24626860
103	Phosphorylation	AAPSCQSSLCVPVSC ECCCCCCCCEEEECC	10.42	24626860
119	Phosphorylation	PVVYAAPSCQSSGCC EEEEECCCCCCCCCC	21.77	24626860

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KR122_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KR122_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KR122_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR122_HUMAN	KRTAP12-2	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
KR261_HUMAN	KRTAP26-1	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KR122_HUMAN

Related Literatures of Post-Translational Modification