FA71C_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FA71C_HUMAN
• UniProt AC: Q8NEG0
• Protein Name: Protein FAM71C
• Gene Name: FAM71C
• Organism: Homo sapiens (Human).
• Sequence Length: 241
• Protein Sequence: MEDCCMLPYYTAQSSPAMGMFNTSMGKLQRQLYKGEYTIFRYAPMFESDFIQISKRGEVIDVHNRARMVTMGIVRTSPCLTLPDVMLLARPAAVCDNARCGPATQKRESPPAEILELTRLLPLMFVKITIHNSVKKQLHLKLATGRSFYLQLCPPSDASEDLFVHWENLVYILRPPVEAYSDTRAILAGNTLDSSVLEEVQRSPVGYAMKFCEEKEQFRISRLHMNAEMFGSTYCDYTIEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	LPYYTAQSSPAMGMF CCCCCCCCCCCCCCC	35.51	24275569
15	Phosphorylation	PYYTAQSSPAMGMFN CCCCCCCCCCCCCCC	12.47	24275569
23	Phosphorylation	PAMGMFNTSMGKLQR CCCCCCCCCHHHHHH	14.61	24275569
33	Phosphorylation	GKLQRQLYKGEYTIF HHHHHHHHCCCEEEE	14.49	24275569
129	Phosphorylation	PLMFVKITIHNSVKK HHHEEEEEECHHHHH	15.51	25003641
133	Phosphorylation	VKITIHNSVKKQLHL EEEEECHHHHHHHEE	22.58	25003641
191	Phosphorylation	RAILAGNTLDSSVLE HHHHCCCCCCHHHHH	30.90	25693802
194	Phosphorylation	LAGNTLDSSVLEEVQ HCCCCCCHHHHHHHH	26.01	30622161
195	Phosphorylation	AGNTLDSSVLEEVQR CCCCCCHHHHHHHHC	30.32	30622161

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FA71C_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FA71C_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FA71C_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.