| UniProt ID | RBTN2_HUMAN | |
|---|---|---|
| UniProt AC | P25791 | |
| Protein Name | Rhombotin-2 | |
| Gene Name | LMO2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 158 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.. | |
| Protein Sequence | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 (in isoform 3) | Phosphorylation | - | 10.60 | - | |
| 28 (in isoform 3) | Phosphorylation | - | 4.34 | 24247654 | |
| 64 (in isoform 3) | Phosphorylation | - | 8.79 | 28450419 | |
| 68 (in isoform 3) | Phosphorylation | - | 12.51 | 28450419 | |
| 71 (in isoform 3) | Phosphorylation | - | 5.44 | 28450419 | |
| 72 (in isoform 3) | Phosphorylation | - | 9.20 | 28450419 | |
| 73 | Phosphorylation | EVGRRLYYKLGRKLC HHHHHHHHHHCHHHH | 12.34 | 22817900 | |
| 74 | Ubiquitination | VGRRLYYKLGRKLCR HHHHHHHHHCHHHHH | 30.79 | 21890473 | |
| 74 (in isoform 1) | Ubiquitination | - | 30.79 | 21890473 | |
| 84 | Phosphorylation | RKLCRRDYLRLFGQD HHHHHHHHHHHHCCC | 7.60 | 22817900 | |
| 104 | Phosphorylation | CDKRIRAYEMTMRVK CHHHHHHHEEEEECC | 9.08 | 22817900 | |
| 143 | Ubiquitination | LLINSDIVCEQDIYE EEECCCEEECHHHHH | 3.36 | 21890473 | |
| 143 (in isoform 3) | Ubiquitination | - | 3.36 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBTN2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBTN2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...