UniProt ID | RBTN2_HUMAN | |
---|---|---|
UniProt AC | P25791 | |
Protein Name | Rhombotin-2 | |
Gene Name | LMO2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization | Nucleus . | |
Protein Description | Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.. | |
Protein Sequence | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 (in isoform 3) | Phosphorylation | - | 10.60 | - | |
28 (in isoform 3) | Phosphorylation | - | 4.34 | 24247654 | |
64 (in isoform 3) | Phosphorylation | - | 8.79 | 28450419 | |
68 (in isoform 3) | Phosphorylation | - | 12.51 | 28450419 | |
71 (in isoform 3) | Phosphorylation | - | 5.44 | 28450419 | |
72 (in isoform 3) | Phosphorylation | - | 9.20 | 28450419 | |
73 | Phosphorylation | EVGRRLYYKLGRKLC HHHHHHHHHHCHHHH | 12.34 | 22817900 | |
74 | Ubiquitination | VGRRLYYKLGRKLCR HHHHHHHHHCHHHHH | 30.79 | 21890473 | |
74 (in isoform 1) | Ubiquitination | - | 30.79 | 21890473 | |
84 | Phosphorylation | RKLCRRDYLRLFGQD HHHHHHHHHHHHCCC | 7.60 | 22817900 | |
104 | Phosphorylation | CDKRIRAYEMTMRVK CHHHHHHHEEEEECC | 9.08 | 22817900 | |
143 | Ubiquitination | LLINSDIVCEQDIYE EEECCCEEECHHHHH | 3.36 | 21890473 | |
143 (in isoform 3) | Ubiquitination | - | 3.36 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBTN2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBTN2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...