| UniProt ID | DAZP2_HUMAN | |
|---|---|---|
| UniProt AC | Q15038 | |
| Protein Name | DAZ-associated protein 2 | |
| Gene Name | DAZAP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 168 | |
| Subcellular Localization | Cytoplasm. Nucleus. Predominantly nuclear in macrophages, stimulation of IL17RB with its ligand IL17E induces accumulation in the cytoplasm. | |
| Protein Description | ||
| Protein Sequence | MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 110 | Phosphorylation | TVLVEGGYDAGARFG EEEEECCCCCCCCCC | 17.30 | - | |
| 131 | Ubiquitination | NIPPPPPGCPPNAAQ CCCCCCCCCCCCHHH | 42.19 | 21906983 | |
| 153 | Ubiquitination | NVLVTQRKGNFFMGG CEEEEECCCCEEECC | 48.68 | 21906983 | |
| 161 | Phosphorylation | GNFFMGGSDGGYTIW CCEEECCCCCCCCCC | 27.61 | 25348954 | |
| 165 | Phosphorylation | MGGSDGGYTIW---- ECCCCCCCCCC---- | 10.69 | 28796482 | |
| 166 | Phosphorylation | GGSDGGYTIW----- CCCCCCCCCC----- | 21.43 | 28796482 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DAZP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DAZP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DAZP2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...