| UniProt ID | VHLL_HUMAN | |
|---|---|---|
| UniProt AC | Q6RSH7 | |
| Protein Name | von Hippel-Lindau-like protein | |
| Gene Name | VHLL | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 139 | |
| Subcellular Localization | ||
| Protein Description | Functions as a dominant-negative VHL to serve as a protector of HIFalpha.. | |
| Protein Sequence | MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | Phosphorylation | AAWPVLRSVNSRELS HHHHHHHCCCCCCCC | 22.84 | 24719451 | |
| 80 | Phosphorylation | YYGKLLPYLTLLPGR HHHHHHHHHHCCCCC | 16.58 | - | |
| 82 | Phosphorylation | GKLLPYLTLLPGRDF HHHHHHHHCCCCCCC | 22.02 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VHLL_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VHLL_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VHLL_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HIF1A_HUMAN | HIF1A | physical | 14757845 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...