UniProt ID | RN208_HUMAN | |
---|---|---|
UniProt AC | Q9H0X6 | |
Protein Name | RING finger protein 208 | |
Gene Name | RNF208 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 261 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPSDPGPEAGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELPAAPCFPPAPRPTPTLAPKRAWPSDTEIIVNQACGGDMPALEGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLSACSIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
102 | Phosphorylation | PRRPRKGSSELGFPR CCCCCCCCCCCCCCC | 24.55 | 22617229 | |
103 | Phosphorylation | RRPRKGSSELGFPRV CCCCCCCCCCCCCCC | 45.57 | 30108239 | |
181 | Phosphorylation | LYESCPKYKFISCPT HHHHCCCCCEEECCC | 9.04 | - | |
209 | Phosphorylation | AALAVNTSILSRLPP HHHHHCHHHHHCCCH | 19.14 | 24719451 | |
212 | Phosphorylation | AVNTSILSRLPPEAL HHCHHHHHCCCHHHH | 30.05 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN208_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN208_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN208_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RN208_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-102, AND MASSSPECTROMETRY. |