| UniProt ID | WDR73_HUMAN | |
|---|---|---|
| UniProt AC | Q6P4I2 | |
| Protein Name | WD repeat-containing protein 73 | |
| Gene Name | WDR73 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 378 | |
| Subcellular Localization | Cytoplasm, cytosol. Cytoplasm, cytoskeleton, spindle . Cytoplasm, cytoskeleton, spindle pole . Cleavage furrow . During interphase, located in the cytosol. During mitosis, accumulates at the spindle poles and microtubule asters and later in the cleav | |
| Protein Description | May play a role in the regulation of microtubule organization and dynamics. [PubMed: 25466283] | |
| Protein Sequence | MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILHLKLPLRLSVKENKGLFPERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQVAEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDWVDLCAPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | GDDWLVESLRLYQDF CCCHHHHHHHHHCEE | 16.00 | 20068231 | |
| 15 | Phosphorylation | LVESLRLYQDFYAFD HHHHHHHHCEEEEEE | 10.29 | - | |
| 47 | Ubiquitination | VAGYESLKKNEILHL EEEEHHCCCCCEEEE | 63.93 | - | |
| 48 | Ubiquitination | AGYESLKKNEILHLK EEEHHCCCCCEEEEE | 66.17 | - | |
| 55 | Ubiquitination | KNEILHLKLPLRLSV CCCEEEEECCEEEEC | 36.99 | - | |
| 63 | Ubiquitination | LPLRLSVKENKGLFP CCEEEECCCCCCCCC | 52.79 | 21890473 | |
| 63 | Acetylation | LPLRLSVKENKGLFP CCEEEECCCCCCCCC | 52.79 | 25953088 | |
| 66 | Ubiquitination | RLSVKENKGLFPERD EEECCCCCCCCCCCC | 59.07 | 21890473 | |
| 84 | Methylation | RHGGFSDRSIFDLKH CCCCCCCCCCEECCC | 30.38 | 115920029 | |
| 90 | Ubiquitination | DRSIFDLKHVPHTRL CCCCEECCCCCCCEE | 44.38 | - | |
| 131 | Acetylation | STIAVHEKEESLWPR EEEEECCCCCCHHHH | 52.48 | 23749302 | |
| 208 | Ubiquitination | GLVDTRQKWAPLENR ECCCCCCCCCCCCCC | 41.87 | - | |
| 216 | Phosphorylation | WAPLENRSPGPGSGG CCCCCCCCCCCCCCC | 45.87 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR73_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR73_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR73_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of WDR73_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 251300 | Galloway-Mowat syndrome (GAMOS) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
