UniProt ID | UB2D4_HUMAN | |
---|---|---|
UniProt AC | Q9Y2X8 | |
Protein Name | Ubiquitin-conjugating enzyme E2 D4 | |
Gene Name | UBE2D4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.. | |
Protein Sequence | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | Phosphorylation | VAFTTKIYHPNINSN EEEEEEEECCCCCCC | 16.87 | 28152594 | |
80 | Phosphorylation | IYHPNINSNGSICLD EECCCCCCCCEEHHH | 38.48 | 24076635 | |
83 | Phosphorylation | PNINSNGSICLDILR CCCCCCCEEHHHHHH | 17.87 | 25849741 | |
144 | Acetylation | LAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | 23894911 | |
144 | Ubiquitination | LAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | 21906983 | |
145 | Phosphorylation | AREWTQKYAM----- HHHHHHHHCC----- | 9.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2D4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2D4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2D4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-144, AND MASS SPECTROMETRY. |