UniProt ID | ZNRF1_HUMAN | |
---|---|---|
UniProt AC | Q8ND25 | |
Protein Name | E3 ubiquitin-protein ligase ZNRF1 | |
Gene Name | ZNRF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 227 | |
Subcellular Localization |
Endosome. Lysosome. Membrane Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Peripheral membrane protein . Associated with synaptic vesicle membranes in neurons. |
|
Protein Description | E3 ubiquitin-protein ligase that mediates the ubiquitination of AKT1 and GLUL, thereby playing a role in neuron cells differentiation. Plays a role in the establishment and maintenance of neuronal transmission and plasticity. Regulates Schwann cells differentiation by mediating ubiquitination of GLUL. Promotes neurodegeneration by mediating 'Lys-48'-linked polyubiquitination and subsequent degradation of AKT1 in axons: degradation of AKT1 prevents AKT1-mediated phosphorylation of GSK3B, leading to GSK3B activation and phosphorylation of DPYSL2/CRMP2 followed by destabilization of microtubule assembly in axons (Probable).. | |
Protein Sequence | MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGGKQSTAA ------CCCCCCCCH | 52.59 | 14561866 | |
6 | Phosphorylation | --MGGKQSTAARSRG --CCCCCCCCHHHCC | 24.41 | 30631047 | |
37 | Phosphorylation | GAPHFGHYRTGGGAM CCCCCCCCCCCCCCC | 15.39 | 28796482 | |
48 | Phosphorylation | GGAMGLRSRSVSSVA CCCCCCCCCCHHHHC | 33.67 | 23401153 | |
50 | Phosphorylation | AMGLRSRSVSSVAGM CCCCCCCCHHHHCCC | 27.83 | 22115753 | |
52 | Phosphorylation | GLRSRSVSSVAGMGM CCCCCCHHHHCCCCC | 21.97 | 22617229 | |
53 | Phosphorylation | LRSRSVSSVAGMGMD CCCCCHHHHCCCCCC | 17.52 | 22115753 | |
62 | Phosphorylation | AGMGMDPSTAGGVPF CCCCCCHHHCCCCCC | 26.99 | 28464451 | |
63 | Phosphorylation | GMGMDPSTAGGVPFG CCCCCHHHCCCCCCE | 34.41 | 28464451 | |
72 | Phosphorylation | GGVPFGLYTPASRGT CCCCCEEECCCCCCC | 15.85 | 26074081 | |
73 | Phosphorylation | GVPFGLYTPASRGTG CCCCEEECCCCCCCC | 19.88 | 26074081 | |
76 | Phosphorylation | FGLYTPASRGTGDSE CEEECCCCCCCCCCC | 32.23 | 26074081 | |
79 | Phosphorylation | YTPASRGTGDSERAP ECCCCCCCCCCCCCC | 36.38 | - | |
91 | Phosphorylation | RAPGGGGSASDSTYA CCCCCCCCCCCCCCC | 28.07 | 28796482 | |
93 | Phosphorylation | PGGGGSASDSTYAHG CCCCCCCCCCCCCCC | 33.52 | 28796482 | |
95 | Phosphorylation | GGGSASDSTYAHGNG CCCCCCCCCCCCCCC | 22.33 | 25884760 | |
96 | Phosphorylation | GGSASDSTYAHGNGY CCCCCCCCCCCCCCC | 29.71 | 28796482 | |
97 | Phosphorylation | GSASDSTYAHGNGYQ CCCCCCCCCCCCCCC | 10.68 | 28796482 | |
103 | Phosphorylation | TYAHGNGYQETGGGH CCCCCCCCCCCCCCC | 13.74 | 28796482 | |
106 | Phosphorylation | HGNGYQETGGGHHRD CCCCCCCCCCCCCCC | 26.12 | 28796482 | |
117 | Phosphorylation | HHRDGMLYLGSRASL CCCCCCEEECCCHHH | 10.50 | 26552605 | |
120 | Phosphorylation | DGMLYLGSRASLADA CCCEEECCCHHHHHH | 23.29 | 26552605 | |
123 | Phosphorylation | LYLGSRASLADALPL EEECCCHHHHHHCCC | 23.99 | 30266825 | |
138 | Phosphorylation | HIAPRWFSSHSGFKC CCCCCHHHCCCCCCC | 21.85 | 28122231 | |
139 | Phosphorylation | IAPRWFSSHSGFKCP CCCCHHHCCCCCCCC | 16.52 | 28122231 | |
141 | Phosphorylation | PRWFSSHSGFKCPIC CCHHHCCCCCCCCCC | 48.12 | 28290473 | |
144 | Ubiquitination | FSSHSGFKCPICSKS HHCCCCCCCCCCCCC | 42.50 | - | |
144 (in isoform 2) | Ubiquitination | - | 42.50 | - | |
150 | Ubiquitination | FKCPICSKSVASDEM CCCCCCCCCCCCCCC | 44.53 | - | |
150 (in isoform 2) | Ubiquitination | - | 44.53 | - | |
167 | Ubiquitination | HFIMCLSKPRLSYND HHHHHHCCCCCCCCC | 22.62 | - | |
167 (in isoform 2) | Ubiquitination | - | 22.62 | - | |
171 | Phosphorylation | CLSKPRLSYNDDVLT HHCCCCCCCCCCCCC | 24.14 | 27050516 | |
172 | Phosphorylation | LSKPRLSYNDDVLTK HCCCCCCCCCCCCCC | 27.48 | 28634298 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZNRF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZNRF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZNRF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433T_HUMAN | YWHAQ | physical | 22797923 | |
AT1A2_HUMAN | ATP1A2 | physical | 22797923 | |
UBE2N_HUMAN | UBE2N | physical | 22797923 | |
ZNRF2_HUMAN | ZNRF2 | physical | 22797923 | |
ZNRF1_HUMAN | ZNRF1 | physical | 19549727 | |
UBE2N_HUMAN | UBE2N | physical | 19549727 | |
UB2D1_HUMAN | UBE2D1 | physical | 19549727 | |
UB2D2_HUMAN | UBE2D2 | physical | 19549727 | |
UB2R1_HUMAN | CDC34 | physical | 19549727 | |
UB2E1_HUMAN | UBE2E1 | physical | 19549727 | |
AT1A1_HUMAN | ATP1A1 | physical | 22797923 | |
UBC_HUMAN | UBC | physical | 22797923 | |
UB2D1_HUMAN | UBE2D1 | physical | 22797923 | |
NMT1_HUMAN | NMT1 | physical | 26186194 | |
NMT2_HUMAN | NMT2 | physical | 26186194 | |
SEN2_HUMAN | TSEN2 | physical | 26186194 | |
BHMT1_HUMAN | BHMT | physical | 26186194 | |
SEN54_HUMAN | TSEN54 | physical | 26186194 | |
FBXW5_HUMAN | FBXW5 | physical | 26186194 | |
NCEH1_HUMAN | NCEH1 | physical | 26186194 | |
SYAM_HUMAN | AARS2 | physical | 26186194 | |
GLNA_HUMAN | GLUL | physical | 20107048 | |
FBXW5_HUMAN | FBXW5 | physical | 28514442 | |
NMT2_HUMAN | NMT2 | physical | 28514442 | |
SEN2_HUMAN | TSEN2 | physical | 28514442 | |
NCEH1_HUMAN | NCEH1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52 AND SER-53, AND MASSSPECTROMETRY. |