UniProt ID | UB2D1_HUMAN | |
---|---|---|
UniProt AC | P51668 | |
Protein Name | Ubiquitin-conjugating enzyme E2 D1 | |
Gene Name | UBE2D1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. [PubMed: 22496338 In vitro catalyzes 'Lys-48'-linked polyubiquitination] | |
Protein Sequence | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Ubiquitination | MALKRIQKELSDLQR CHHHHHHHHHHHHHH | 59.25 | - | |
11 | Phosphorylation | KRIQKELSDLQRDPP HHHHHHHHHHHHCCC | 37.05 | 27499020 | |
74 | Phosphorylation | IAFTTKIYHPNINSN EEEEEEECCCCCCCC | 16.87 | 28152594 | |
80 | Phosphorylation | IYHPNINSNGSICLD ECCCCCCCCCEEHHH | 38.48 | 24076635 | |
83 | Phosphorylation | PNINSNGSICLDILR CCCCCCCEEHHHHHH | 17.87 | 25849741 | |
144 | Acetylation | HAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | 25953088 | |
144 | Ubiquitination | HAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | 21906983 | |
145 | Phosphorylation | AREWTQKYAM----- HHHHHHHHCC----- | 9.70 | 20736484 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2D1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2D1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...