UniProt ID | ANCHR_HUMAN | |
---|---|---|
UniProt AC | Q96K21 | |
Protein Name | Abscission/NoCut checkpoint regulator | |
Gene Name | ZFYVE19 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 471 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cleavage furrow . Midbody, Midbody ring . Localizes mainly on centrosomes in interphase and early mitosis. Localizes at the cleavage furrow and midbody ring in late mitosis and cyto | |
Protein Description | Key regulator of abscission step in cytokinesis: part of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage. Together with CHMP4C, required to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ZFYVE19/ANCHR and VPS4 and subsequent abscission.. | |
Protein Sequence | MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSWGEGPRGPGLGRRDLSSADPAVLGATMESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MNYDSQQPPL -----CCCCCCCCCC | 21253578 | ||
5 | Phosphorylation | ---MNYDSQQPPLPP ---CCCCCCCCCCCC | 21253578 | ||
15 | Phosphorylation | PPLPPLPYAGCRRAS CCCCCCCCCCCCCCC | 21253578 | ||
16 | Ubiquitination | PLPPLPYAGCRRASG CCCCCCCCCCCCCCC | 29967540 | ||
22 | Phosphorylation | YAGCRRASGFPALGR CCCCCCCCCCCCCCC | - | ||
32 | Ubiquitination | PALGRGGTVPVGVWG CCCCCCCEECCEECC | 33845483 | ||
105 | Phosphorylation | NCGRAFCSGCLSFSA CCCCEECCHHCCEEE | 27251275 | ||
116 | Ubiquitination | SFSAAVPRTGNTQQK CEEEECCCCCCHHHH | 29967540 | ||
119 | Ubiquitination | AAVPRTGNTQQKVCK EECCCCCCHHHHHHH | 29967540 | ||
126 | Ubiquitination | NTQQKVCKQCHEVLT CHHHHHHHHHHHHHH | 29967540 | ||
130 | Ubiquitination | KVCKQCHEVLTRGSS HHHHHHHHHHHCCCC | 29967540 | ||
134 | Phosphorylation | QCHEVLTRGSSANAS HHHHHHHCCCCCCHH | 32645325 | ||
136 | Phosphorylation | HEVLTRGSSANASKW HHHHHCCCCCCHHHC | 23403867 | ||
137 | Phosphorylation | EVLTRGSSANASKWS HHHHCCCCCCHHHCC | 23403867 | ||
141 | Phosphorylation | RGSSANASKWSPPQN CCCCCCHHHCCCCCC | 22617229 | ||
144 | Phosphorylation | SANASKWSPPQNYKK CCCHHHCCCCCCHHH | 20201521 | ||
149 | Ubiquitination | KWSPPQNYKKRVAAL HCCCCCCHHHHHHHH | 33845483 | ||
149 | Phosphorylation | KWSPPQNYKKRVAAL HCCCCCCHHHHHHHH | 23403867 | ||
151 | Ubiquitination | SPPQNYKKRVAALEA CCCCCHHHHHHHHHH | 29967540 | ||
159 | Ubiquitination | RVAALEAKQKPSTSQ HHHHHHHHHCCCCHH | 33845483 | ||
161 | Ubiquitination | AALEAKQKPSTSQSQ HHHHHHHCCCCHHHC | 29967540 | ||
163 | O-linked_Glycosylation | LEAKQKPSTSQSQGL HHHHHCCCCHHHCCC | 30059200 | ||
164 | O-linked_Glycosylation | EAKQKPSTSQSQGLT HHHHCCCCHHHCCCC | 30059200 | ||
164 | Phosphorylation | EAKQKPSTSQSQGLT HHHHCCCCHHHCCCC | 20068231 | ||
165 | O-linked_Glycosylation | AKQKPSTSQSQGLTR HHHCCCCHHHCCCCH | 30059200 | ||
167 | O-linked_Glycosylation | QKPSTSQSQGLTRQD HCCCCHHHCCCCHHH | 30059200 | ||
179 | Phosphorylation | RQDQMIAERLARLRQ HHHHHHHHHHHHHHH | 32142685 | ||
181 | Ubiquitination | DQMIAERLARLRQEN HHHHHHHHHHHHHHC | 29967540 | ||
191 | Ubiquitination | LRQENKPKLVPSQAE HHHHCCCCCCCCHHH | 29967540 | ||
197 | Ubiquitination | PKLVPSQAEIEARLA CCCCCCHHHHHHHHH | 33845483 | ||
207 | Sumoylation | EARLAALKDERQGSI HHHHHHHHHHHCCCC | - | ||
207 | Sumoylation | EARLAALKDERQGSI HHHHHHHHHHHCCCC | 28112733 | ||
207 | Ubiquitination | EARLAALKDERQGSI HHHHHHHHHHHCCCC | 33845483 | ||
213 | Phosphorylation | LKDERQGSIPSTQEM HHHHHCCCCCCHHHH | 28555341 | ||
216 | Phosphorylation | ERQGSIPSTQEMEAR HHCCCCCCHHHHHHH | 22817900 | ||
217 | Phosphorylation | RQGSIPSTQEMEARL HCCCCCCHHHHHHHH | 17525332 | ||
220 | Sulfoxidation | SIPSTQEMEARLAAL CCCCHHHHHHHHHHH | 21406390 | ||
234 | Phosphorylation | LQGRVLPSQTPQPAH HCCCCCCCCCCCCCC | 25159151 | ||
236 | Phosphorylation | GRVLPSQTPQPAHHT CCCCCCCCCCCCCCC | 30266825 | ||
243 | Phosphorylation | TPQPAHHTPDTRTQA CCCCCCCCCCCHHHH | 30266825 | ||
246 | Phosphorylation | PAHHTPDTRTQAQQT CCCCCCCCHHHHHHH | 30266825 | ||
277 (in isoform 3) | Phosphorylation | - | 23927012 | ||
278 | Phosphorylation | KGGGPAASLQNDLNQ CCCCCCHHHCCCHHC | 23186163 | ||
281 (in isoform 3) | Phosphorylation | - | 28796482 | ||
284 | Ubiquitination | ASLQNDLNQGGPGST HHHCCCHHCCCCCCC | 29967540 | ||
286 (in isoform 3) | Phosphorylation | - | 25159151 | ||
286 | Phosphorylation | LQNDLNQGGPGSTNS HCCCHHCCCCCCCCH | 32142685 | ||
290 | Phosphorylation | LNQGGPGSTNSKRQA HHCCCCCCCCHHHHC | 25159151 | ||
291 | Phosphorylation | NQGGPGSTNSKRQAN HCCCCCCCCHHHHCC | 25627689 | ||
293 | Phosphorylation | GGPGSTNSKRQANWS CCCCCCCHHHHCCCC | 23186163 | ||
294 (in isoform 3) | Phosphorylation | - | 23090842 | ||
294 | Ubiquitination | GPGSTNSKRQANWSL CCCCCCHHHHCCCCH | 29967540 | ||
295 | Ubiquitination | PGSTNSKRQANWSLE CCCCCHHHHCCCCHH | 29967540 | ||
300 | Phosphorylation | SKRQANWSLEEEKSR HHHHCCCCHHHHHHH | 28348404 | ||
305 | Ubiquitination | NWSLEEEKSRLLAEA CCCHHHHHHHHHHHH | 29967540 | ||
331 | Ubiquitination | ERILALAKRLAMLRG HHHHHHHHHHHHHCC | - | ||
344 | Phosphorylation | RGQDPERVTLQDYRL CCCCCCCCEEECCCC | 32142685 | ||
345 | Phosphorylation | GQDPERVTLQDYRLP CCCCCCCEEECCCCC | 28464451 | ||
349 | Phosphorylation | ERVTLQDYRLPDSDD CCCEEECCCCCCCCC | 28796482 | ||
354 | Phosphorylation | QDYRLPDSDDDEDEE ECCCCCCCCCCCCHH | 19664994 | ||
362 | Phosphorylation | DDDEDEETAIQRVLQ CCCCCHHHHHHHHHH | 23927012 | ||
376 | Phosphorylation | QQLTEEASLDEASGF HHHHHHCCCCCCCCC | 24719451 | ||
459 | Phosphorylation | FELKEHQTSAYSPPR EEECCCCCCCCCCCC | 30266825 | ||
460 | Phosphorylation | ELKEHQTSAYSPPRA EECCCCCCCCCCCCC | 30266825 | ||
462 | Phosphorylation | KEHQTSAYSPPRAGQ CCCCCCCCCCCCCCC | 30266825 | ||
463 | Phosphorylation | EHQTSAYSPPRAGQE CCCCCCCCCCCCCCC | 20201521 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
22 | S | Phosphorylation | Kinase | AURB | Q96GD4 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANCHR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANCHR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433S_HUMAN | SFN | physical | 22863883 | |
MITD1_HUMAN | MITD1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...