UniProt ID | MITD1_HUMAN | |
---|---|---|
UniProt AC | Q8WV92 | |
Protein Name | MIT domain-containing protein 1 | |
Gene Name | MITD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 249 | |
Subcellular Localization |
Late endosome membrane Peripheral membrane protein Cytoplasmic side. Midbody. Membrane Peripheral membrane protein Cytoplasmic side. During cytokinesis, recruited to the midbody via interaction with CHMP1A. Interacts with membranes enriched in ph |
|
Protein Description | Required for efficient abscission at the end of cytokinesis, together with components of the ESCRT-III complex.. | |
Protein Sequence | MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAKSGLRQDPQ ----CCCCCCCCCHH | 33.26 | 29759185 | |
12 | Phosphorylation | GLRQDPQSTAAATVL CCCCCHHHHHHHHHH | 25.96 | 28787133 | |
13 | Phosphorylation | LRQDPQSTAAATVLK CCCCHHHHHHHHHHH | 18.31 | 28787133 | |
17 | Phosphorylation | PQSTAAATVLKRAVE HHHHHHHHHHHHHHH | 22.96 | 28787133 | |
20 | Ubiquitination | TAAATVLKRAVELDS HHHHHHHHHHHHCCC | 33.69 | 29967540 | |
38 | Phosphorylation | YPQALVCYQEGIDLL CCCEEHHHHHHHHHH | 11.34 | 18452278 | |
67 | Ubiquitination | NLREKISKYMDRAEN CHHHHHHHHHHHHHH | 48.33 | - | |
68 | Phosphorylation | LREKISKYMDRAENI HHHHHHHHHHHHHHH | 9.47 | 18452278 | |
78 | Phosphorylation | RAENIKKYLDQEKED HHHHHHHHHHHHHCC | 15.54 | 26074081 | |
87 | Ubiquitination | DQEKEDGKYHKQIKI HHHHCCCCEEEEEEC | 57.41 | - | |
88 | Phosphorylation | QEKEDGKYHKQIKIE HHHCCCCEEEEEECE | 21.56 | 29496907 | |
128 | Phosphorylation | EDPYIRHTHQLYNFL CCCCCCHHHHHHHHH | 11.06 | 29396449 | |
132 | Phosphorylation | IRHTHQLYNFLRFCE CCHHHHHHHHHHHHH | 9.41 | 29396449 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MITD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MITD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MITD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MITD1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...