UniProt ID | RN150_HUMAN | |
---|---|---|
UniProt AC | Q9ULK6 | |
Protein Name | RING finger protein 150 | |
Gene Name | RNF150 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 438 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | ||
Protein Sequence | MAMSLIQACCSLALSTWLLSFCFVHLLCLDFTVAEKEEWYTAFVNITYAEPAPDPGAGAAGGGGAELHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKIRNAFLQNASAVVIFNVGSNTNETITMPHAGVEDIVAIMIPEPKGKEIVSLLERNITVTMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAVCIEGYKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPTDFEGSLGGPPTNQITGASDTTVNESSVTLDPAVRTVGALQVVQDTDPIPQEGDVIFTTNSEQEPAVSSDSDISLIMAMEVGLSDVELSTDQDCEEVKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 (in isoform 4) | Phosphorylation | - | 3.02 | 25690035 | |
12 (in isoform 4) | Phosphorylation | - | 3.29 | 22210691 | |
45 | N-linked_Glycosylation | EWYTAFVNITYAEPA HHEEEEEEEEECCCC | 17.90 | UniProtKB CARBOHYD | |
107 | Ubiquitination | LACDPNTKFAAPTRG CCCCCCCCCCCCCCC | 39.38 | - | |
125 | N-linked_Glycosylation | IALIPKGNCTYRDKI EEEEECCCCCHHHHH | 22.53 | UniProtKB CARBOHYD | |
153 | N-linked_Glycosylation | FNVGSNTNETITMPH EECCCCCCCEEECCC | 48.98 | UniProtKB CARBOHYD | |
186 | N-linked_Glycosylation | IVSLLERNITVTMYI HHHHHHCCEEEEEEE | 25.55 | UniProtKB CARBOHYD | |
194 | Phosphorylation | ITVTMYITIGTRNLQ EEEEEEEEECCCHHH | 8.89 | - | |
197 | Phosphorylation | TMYITIGTRNLQKYV EEEEEECCCHHHHHH | 16.72 | - | |
258 | Ubiquitination | AAKKAISKLQIRTIK HHHHHHHHHHHEEEC | 37.99 | - | |
269 | Ubiquitination | RTIKKGDKETESDFD EEECCCCCCCCCCCC | 75.18 | - | |
303 | Phosphorylation | CRHLFHKSCVDPWLL CCHHCCCHHCCHHHC | 15.71 | 28122231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN150_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN150_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN150_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNN1_HUMAN | CNN1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...