TRI31_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRI31_HUMAN
• UniProt AC: Q9BZY9
• Protein Name: E3 ubiquitin-protein ligase TRIM31
• Gene Name: TRIM31
• Organism: Homo sapiens (Human).
• Sequence Length: 425
• Subcellular Localization: Cytoplasm . Mitochondrion . Predominantly expressed in the cytoplasm but a fraction is associated with the mitochondria.
• Protein Description: Regulator of Src-induced anchorage independent cell growth (By similarity). May have E3 ubiquitin-protein ligase activity..
• Protein Sequence: MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
114	S-palmitoylation	EDDGKFLCFVCRESK CCCCCEEEEEEECCC	2.43	27216961
117	S-palmitoylation	GKFLCFVCRESKDHK CCEEEEEEECCCCCC	1.68	27216961
281	O-linked_Glycosylation	KKLSEAKSRHDSITG HHHHHHHHCHHHHHH	41.73	29351928
287	Phosphorylation	KSRHDSITGSLKKFK HHCHHHHHHHHHHHH	25.35	22210691
289	Phosphorylation	RHDSITGSLKKFKDQ CHHHHHHHHHHHHHH	28.50	22210691
333	Phosphorylation	NNHKMNKTSEPGSSS CCCCCCCCCCCCCCC	33.06	21712546
339	Phosphorylation	KTSEPGSSSAGGRTT CCCCCCCCCCCCCCC	30.07	-
340	Phosphorylation	TSEPGSSSAGGRTTS CCCCCCCCCCCCCCC	32.41	21712546

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TRIM31	Q9BZY9	PMID:18773414

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRI31_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRI31_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRI31_HUMAN	TRIM31	physical	11331580
TRI23_HUMAN	TRIM23	physical	11331580
ZSCA1_HUMAN	ZSCAN1	physical	20211142
UB2D1_HUMAN	UBE2D1	physical	21143188
UB2D2_HUMAN	UBE2D2	physical	21143188
UB2D3_HUMAN	UBE2D3	physical	21143188
TRI27_HUMAN	TRIM27	physical	22493164
MKRN3_HUMAN	MKRN3	physical	22493164
NSE4A_HUMAN	NSMCE4A	physical	25590999
MAGA1_HUMAN	MAGEA1	physical	25590999
EID3_HUMAN	EID3	physical	25590999
MAVS_HUMAN	MAVS	physical	27992402

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.