| UniProt ID | UB2D3_HUMAN | |
|---|---|---|
| UniProt AC | P61077 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 D3 | |
| Gene Name | UBE2D3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 147 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein . Endosome membrane Peripheral membrane protein . |
|
| Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also as an initiator E2, in conjunction with RNF8, for the priming of PCNA. Monoubiquitination of PCNA, and its subsequent polyubiquitination, are essential events in the operation of the DNA damage tolerance (DDT) pathway that is activated after DNA damage caused by UV or chemical agents during S-phase. Associates with the BRCA1/BARD1 E3 ligase complex to perform ubiquitination at DNA damage sites following ionizing radiation leading to DNA repair. Targets DAPK3 for ubiquitination which influences promyelocytic leukemia protein nuclear body (PML-NB) formation in the nucleus. In conjunction with the MDM2 and TOPORS E3 ligases, functions ubiquitination of p53/TP53. Supports NRDP1-mediated ubiquitination and degradation of ERBB3 and of BRUCE which triggers apoptosis. In conjunction with the CBL E3 ligase, targets EGFR for polyubiquitination at the plasma membrane as well as during its internalization and transport on endosomes. In conjunction with the STUB1 E3 quality control E3 ligase, ubiquitinates unfolded proteins to catalyze their immediate destruction.. | |
| Protein Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 (in isoform 3) | Phosphorylation | - | 3.55 | 20068231 | |
| 8 (in isoform 2) | Ubiquitination | - | 58.63 | 21890473 | |
| 8 (in isoform 1) | Ubiquitination | - | 58.63 | 21890473 | |
| 8 | Ubiquitination | MALKRINKELSDLAR CCHHHHHHHHHHHHH | 58.63 | 21906983 | |
| 8 | Acetylation | MALKRINKELSDLAR CCHHHHHHHHHHHHH | 58.63 | 26051181 | |
| 9 (in isoform 3) | Phosphorylation | - | 49.36 | 20068231 | |
| 11 | Phosphorylation | KRINKELSDLARDPP HHHHHHHHHHHHCCC | 31.50 | 28857561 | |
| 13 (in isoform 3) | Phosphorylation | - | 3.65 | 20068231 | |
| 74 | Phosphorylation | VAFTTRIYHPNINSN EEEEEEEECCCCCCC | 14.13 | 28152594 | |
| 80 | Phosphorylation | IYHPNINSNGSICLD EECCCCCCCCEEHHH | 38.48 | 24076635 | |
| 83 | Phosphorylation | PNINSNGSICLDILR CCCCCCCEEHHHHHH | 17.87 | 25849741 | |
| 94 | Phosphorylation | DILRSQWSPALTISK HHHHHCCCCCHHHHH | 7.83 | - | |
| 98 | Phosphorylation | SQWSPALTISKVLLS HCCCCCHHHHHHHHH | 25.88 | 21712546 | |
| 101 | Ubiquitination | SPALTISKVLLSICS CCCHHHHHHHHHHHH | 32.81 | - | |
| 105 | Phosphorylation | TISKVLLSICSLLCD HHHHHHHHHHHHHCC | 19.86 | - | |
| 128 | Ubiquitination | PEIARIYKTDRDKYN HHHHHHHCCCHHHHH | 41.39 | - | |
| 128 | Succinylation | PEIARIYKTDRDKYN HHHHHHHCCCHHHHH | 41.39 | 23954790 | |
| 130 (in isoform 3) | Ubiquitination | - | 53.26 | - | |
| 133 | Acetylation | IYKTDRDKYNRISRE HHCCCHHHHHHHCHH | 45.37 | 26051181 | |
| 133 | Ubiquitination | IYKTDRDKYNRISRE HHCCCHHHHHHHCHH | 45.37 | - | |
| 144 | Ubiquitination | ISREWTQKYAM---- HCHHHHHHHCC---- | 27.83 | 21906983 | |
| 144 | Acetylation | ISREWTQKYAM---- HCHHHHHHHCC---- | 27.83 | 21791702 | |
| 145 | Phosphorylation | SREWTQKYAM----- CHHHHHHHCC----- | 9.70 | - | |
| 146 (in isoform 3) | Ubiquitination | - | 12.30 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2D3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2D3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...