RN185_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RN185_HUMAN
• UniProt AC: Q96GF1
• Protein Name: E3 ubiquitin-protein ligase RNF185
• Gene Name: RNF185
• Organism: Homo sapiens (Human).
• Sequence Length: 192
• Subcellular Localization: Mitochondrion outer membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1. [PubMed: 21931693 Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation]
• Protein Sequence: MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
80	Ubiquitination	RQVCPVCKAGISRDK CCCCCCCCCCCCCCC	50.29	21890473
80	Ubiquitination	RQVCPVCKAGISRDK CCCCCCCCCCCCCCC	50.29	21890473
80 (in isoform 1)	Ubiquitination	-	50.29	21890473
87	Ubiquitination	KAGISRDKVIPLYGR CCCCCCCCEEECCCC	40.74	21890473
87	Ubiquitination	KAGISRDKVIPLYGR CCCCCCCCEEECCCC	40.74	21890473
87 (in isoform 1)	Ubiquitination	-	40.74	21890473
94	Dimethylation	KVIPLYGRGSTGQQD CEEECCCCCCCCCCC	23.49	-
94	Methylation	KVIPLYGRGSTGQQD CEEECCCCCCCCCCC	23.49	24412319
96	Phosphorylation	IPLYGRGSTGQQDPR EECCCCCCCCCCCCC	28.18	29214152
103	Dimethylation	STGQQDPREKTPPRP CCCCCCCCCCCCCCC	67.35	-
103	Methylation	STGQQDPREKTPPRP CCCCCCCCCCCCCCC	67.35	24412329
105	Ubiquitination	GQQDPREKTPPRPQG CCCCCCCCCCCCCCC	68.55	21906983
105 (in isoform 1)	Ubiquitination	-	68.55	21890473
106	Phosphorylation	QQDPREKTPPRPQGQ CCCCCCCCCCCCCCC	33.50	23403867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RN185_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RN185_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RN185_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA4_HUMAN	PSMA4	physical	17558393
PSA5_HUMAN	PSMA5	physical	17558393
PSA6_HUMAN	PSMA6	physical	17558393
PSA7_HUMAN	PSMA7	physical	17558393
PRS7_HUMAN	PSMC2	physical	17558393
PRS6A_HUMAN	PSMC3	physical	17558393
PRS8_HUMAN	PSMC5	physical	17558393
PSD12_HUMAN	PSMD12	physical	17558393
PSMD8_HUMAN	PSMD8	physical	17558393
RD23B_HUMAN	RAD23B	physical	17558393
UBC_HUMAN	UBC	physical	17558393
UBB_HUMAN	UBB	physical	17558393
UBL4A_HUMAN	UBL4A	physical	17558393
UBQL1_HUMAN	UBQLN1	physical	17558393
UBQL2_HUMAN	UBQLN2	physical	17558393
UBQL4_HUMAN	UBQLN4	physical	17558393
RPN1_HUMAN	RPN1	physical	17558393
RPN2_HUMAN	RPN2	physical	17558393
BAP31_HUMAN	BCAP31	physical	17558393
RACK1_HUMAN	GNB2L1	physical	17558393
UBE2K_HUMAN	UBE2K	physical	17558393
MAGD1_HUMAN	MAGED1	physical	17558393
MARE2_HUMAN	MAPRE2	physical	17558393
PHB2_HUMAN	PHB2	physical	17558393
KPYM_HUMAN	PKM	physical	17558393
SGTA_HUMAN	SGTA	physical	17558393
ERLN2_HUMAN	ERLIN2	physical	17558393
SRP54_HUMAN	SRP54	physical	17558393
SRP68_HUMAN	SRP68	physical	17558393
LAP2A_HUMAN	TMPO	physical	17558393
LAP2B_HUMAN	TMPO	physical	17558393
TOM70_HUMAN	TOMM70A	physical	17558393
ENPL_HUMAN	HSP90B1	physical	17558393
SEC20_HUMAN	BNIP1	physical	21931693
A4_HUMAN	APP	physical	21832049
DVL2_HUMAN	DVL2	physical	24727453
RN185_HUMAN	RNF185	physical	25416956
CKLF5_HUMAN	CMTM5	physical	25416956
RN185_HUMAN	RNF185	physical	24019521
UB2D3_HUMAN	UBE2D3	physical	24019521
UB2J1_HUMAN	UBE2J1	physical	24019521
UB2J2_HUMAN	UBE2J2	physical	24019521
DERL1_HUMAN	DERL1	physical	24019521
ERLN2_HUMAN	ERLIN2	physical	24019521
CFTR_HUMAN	CFTR	physical	24019521
COA1_HUMAN	COA1	physical	28514442
PCX3_HUMAN	PCNXL3	physical	28514442
MBRL_HUMAN	TMEM259	physical	28514442
ST7L_HUMAN	ST7L	physical	28514442
C102A_HUMAN	CCDC102A	physical	28514442
TUSC3_HUMAN	TUSC3	physical	28514442
BI1_HUMAN	TMBIM6	physical	28514442
RHBL4_HUMAN	RHBDD1	physical	28514442
CGAS_HUMAN	MB21D1	physical	28273161
CALX_HUMAN	CANX	physical	28273161

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.