UniProt ID | RN185_HUMAN | |
---|---|---|
UniProt AC | Q96GF1 | |
Protein Name | E3 ubiquitin-protein ligase RNF185 | |
Gene Name | RNF185 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 192 | |
Subcellular Localization |
Mitochondrion outer membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1. [PubMed: 21931693 Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation] | |
Protein Sequence | MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
80 | Ubiquitination | RQVCPVCKAGISRDK CCCCCCCCCCCCCCC | 50.29 | 21890473 | |
80 | Ubiquitination | RQVCPVCKAGISRDK CCCCCCCCCCCCCCC | 50.29 | 21890473 | |
80 (in isoform 1) | Ubiquitination | - | 50.29 | 21890473 | |
87 | Ubiquitination | KAGISRDKVIPLYGR CCCCCCCCEEECCCC | 40.74 | 21890473 | |
87 | Ubiquitination | KAGISRDKVIPLYGR CCCCCCCCEEECCCC | 40.74 | 21890473 | |
87 (in isoform 1) | Ubiquitination | - | 40.74 | 21890473 | |
94 | Dimethylation | KVIPLYGRGSTGQQD CEEECCCCCCCCCCC | 23.49 | - | |
94 | Methylation | KVIPLYGRGSTGQQD CEEECCCCCCCCCCC | 23.49 | 24412319 | |
96 | Phosphorylation | IPLYGRGSTGQQDPR EECCCCCCCCCCCCC | 28.18 | 29214152 | |
103 | Dimethylation | STGQQDPREKTPPRP CCCCCCCCCCCCCCC | 67.35 | - | |
103 | Methylation | STGQQDPREKTPPRP CCCCCCCCCCCCCCC | 67.35 | 24412329 | |
105 | Ubiquitination | GQQDPREKTPPRPQG CCCCCCCCCCCCCCC | 68.55 | 21906983 | |
105 (in isoform 1) | Ubiquitination | - | 68.55 | 21890473 | |
106 | Phosphorylation | QQDPREKTPPRPQGQ CCCCCCCCCCCCCCC | 33.50 | 23403867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN185_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN185_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN185_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...