UniProt ID | COA1_HUMAN | |
---|---|---|
UniProt AC | Q9GZY4 | |
Protein Name | Cytochrome c oxidase assembly factor 1 homolog | |
Gene Name | COA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 146 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for assembly of mitochondrial respiratory chain complex I and complex IV.. | |
Protein Sequence | MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MMWQKYAGSRRS ---CCCCCCCCCCCC | - | ||
74 | Ubiquitination | PLNIHYLKLIDRENF CCEEEEEEECCCCCC | 21906983 | ||
88 | Ubiquitination | FVDIVDAKLKIPVSG CEEEEEEEEECCCCC | 21906983 | ||
90 | Ubiquitination | DIVDAKLKIPVSGSK EEEEEEEECCCCCCC | 21906983 | ||
97 | Ubiquitination | KIPVSGSKSEGLLYV ECCCCCCCCCEEEEE | 21906983 | ||
125 | Ubiquitination | DEVFLELKDGQQIPV CEEEEEECCCCEEEE | 21906983 | ||
134 | Ubiquitination | GQQIPVFKLSGENGD CCEEEEEEEECCCCC | 21906983 | ||
144 | Ubiquitination | GENGDEVKKE----- CCCCCCCCCC----- | - | ||
145 | Ubiquitination | ENGDEVKKE------ CCCCCCCCC------ | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
COX17_HUMAN | COX17 | physical | 22356826 | |
COA6_HUMAN | COA6 | physical | 22356826 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...