| UniProt ID | COA1_HUMAN | |
|---|---|---|
| UniProt AC | Q9GZY4 | |
| Protein Name | Cytochrome c oxidase assembly factor 1 homolog | |
| Gene Name | COA1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 146 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for assembly of mitochondrial respiratory chain complex I and complex IV.. | |
| Protein Sequence | MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Ubiquitination | ---MMWQKYAGSRRS ---CCCCCCCCCCCC | - | ||
| 74 | Ubiquitination | PLNIHYLKLIDRENF CCEEEEEEECCCCCC | 21906983 | ||
| 88 | Ubiquitination | FVDIVDAKLKIPVSG CEEEEEEEEECCCCC | 21906983 | ||
| 90 | Ubiquitination | DIVDAKLKIPVSGSK EEEEEEEECCCCCCC | 21906983 | ||
| 97 | Ubiquitination | KIPVSGSKSEGLLYV ECCCCCCCCCEEEEE | 21906983 | ||
| 125 | Ubiquitination | DEVFLELKDGQQIPV CEEEEEECCCCEEEE | 21906983 | ||
| 134 | Ubiquitination | GQQIPVFKLSGENGD CCEEEEEEEECCCCC | 21906983 | ||
| 144 | Ubiquitination | GENGDEVKKE----- CCCCCCCCCC----- | - | ||
| 145 | Ubiquitination | ENGDEVKKE------ CCCCCCCCC------ | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| COX17_HUMAN | COX17 | physical | 22356826 | |
| COA6_HUMAN | COA6 | physical | 22356826 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...