UniProt ID | COA6_HUMAN | |
---|---|---|
UniProt AC | Q5JTJ3 | |
Protein Name | Cytochrome c oxidase assembly factor 6 homolog | |
Gene Name | COA6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | Mitochondrion intermembrane space . | |
Protein Description | Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.. | |
Protein Sequence | MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 (in isoform 3) | Acetylation | - | 22814378 | ||
9 | Phosphorylation | GPGGPLLSPSRGFLL CCCCCCCCCCCCEEE | 30619164 | ||
34 | Ubiquitination | LGDCGPHTPVSTALS CCCCCCCCCHHHHHH | 32015554 | ||
50 (in isoform 3) | Ubiquitination | - | 21890473 | ||
50 | Ubiquitination | IAVGMAAPSMKERQV HHHHCCCCCHHHHCC | 21890473 | ||
51 | Phosphorylation | AVGMAAPSMKERQVC HHHCCCCCHHHHCCH | 20068231 | ||
53 | Acetylation | GMAAPSMKERQVCWG HCCCCCHHHHCCHHH | 25953088 | ||
64 (in isoform 3) | Ubiquitination | - | 21890473 | ||
64 | Ubiquitination | VCWGARDEYWKCLDE CHHHCCHHHHHHHHH | 21890473 | ||
71 (in isoform 2) | Phosphorylation | - | 20068231 | ||
72 (in isoform 2) | Phosphorylation | - | 20068231 | ||
80 | Acetylation | LEDASQCKKLRSSFE CCCHHHHHHHHHHHH | 25953088 | ||
80 | Ubiquitination | LEDASQCKKLRSSFE CCCHHHHHHHHHHHH | 32015554 | ||
82 (in isoform 2) | Phosphorylation | - | 20068231 | ||
84 | Phosphorylation | SQCKKLRSSFESSCP HHHHHHHHHHHHCCC | 25159151 | ||
85 | Phosphorylation | QCKKLRSSFESSCPQ HHHHHHHHHHHCCCH | 25159151 | ||
88 | Phosphorylation | KLRSSFESSCPQQWI HHHHHHHHCCCHHHH | 26074081 | ||
89 | Phosphorylation | LRSSFESSCPQQWIK HHHHHHHCCCHHHHH | 27080861 | ||
96 (in isoform 1) | Ubiquitination | - | 21890473 | ||
96 | Ubiquitination | SCPQQWIKYFDKRRD CCCHHHHHHHHHHHH | 21890473 | ||
97 | Phosphorylation | CPQQWIKYFDKRRDY CCHHHHHHHHHHHHH | 26074081 | ||
110 | Acetylation | DYLKFKEKFEAGQFE HHHHHHHHHHCCCCC | 25038526 | ||
110 (in isoform 1) | Ubiquitination | - | 21890473 | ||
110 | Ubiquitination | DYLKFKEKFEAGQFE HHHHHHHHHHCCCCC | 32015554 | ||
119 | Phosphorylation | EAGQFEPSETTAKS- HCCCCCCCCCCCCC- | 25627689 | ||
121 | Phosphorylation | GQFEPSETTAKS--- CCCCCCCCCCCC--- | 25159151 | ||
122 | Phosphorylation | QFEPSETTAKS---- CCCCCCCCCCC---- | 27251275 | ||
125 | Phosphorylation | PSETTAKS------- CCCCCCCC------- | 25159151 | ||
126 | Ubiquitination | SETTAKS-------- CCCCCCC-------- | 21890473 | ||
127 (in isoform 2) | Ubiquitination | - | 21890473 | ||
140 | Ubiquitination | ---------------------- ---------------------- | 21890473 | ||
141 (in isoform 2) | Ubiquitination | - | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SCO2_HUMAN | SCO2 | physical | 25959673 | |
COX2_HUMAN | COX2 | physical | 25959673 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...