| UniProt ID | SCO2_HUMAN | |
|---|---|---|
| UniProt AC | O43819 | |
| Protein Name | Protein SCO2 homolog, mitochondrial | |
| Gene Name | SCO2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 266 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Involved in transporting copper to the Cu(A) site on MT-CO2/COX2. [PubMed: 15229189] | |
| Protein Sequence | MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MLLLTRSPTAWHRL -CCCCCCCCCHHHHH | 22.74 | 24719451 | |
| 9 | Phosphorylation | LLLTRSPTAWHRLSQ CCCCCCCCHHHHHHH | 43.56 | 24719451 | |
| 15 | Phosphorylation | PTAWHRLSQLKPRVL CCHHHHHHHCCCCCC | 33.16 | 24719451 | |
| 35 | Phosphorylation | GQALHLRSWLLSRQG HHHHHHHHHHHHCCC | 28.56 | - | |
| 39 | Phosphorylation | HLRSWLLSRQGPAET HHHHHHHHCCCCCCC | 22.01 | - | |
| 46 | Phosphorylation | SRQGPAETGGQGQPQ HCCCCCCCCCCCCCC | 49.03 | - | |
| 59 | Phosphorylation | PQGPGLRTRLLITGL CCCCCHHHHHHHHCC | 30.61 | - | |
| 180 | Phosphorylation | DVEAMARYVQDFHPR HHHHHHHHHHHHHHH | 7.91 | 29496907 | |
| 192 | Phosphorylation | HPRLLGLTGSTKQVA HHHHHCCCCCHHHHH | 27.56 | 30108239 | |
| 194 | Phosphorylation | RLLGLTGSTKQVAQA HHHCCCCCHHHHHHH | 27.48 | 30108239 | |
| 195 | Phosphorylation | LLGLTGSTKQVAQAS HHCCCCCHHHHHHHH | 27.17 | 30108239 | |
| 196 | Malonylation | LGLTGSTKQVAQASH HCCCCCHHHHHHHHC | 44.46 | 26320211 | |
| 196 | Ubiquitination | LGLTGSTKQVAQASH HCCCCCHHHHHHHHC | 44.46 | 21963094 | |
| 202 | Phosphorylation | TKQVAQASHSYRVYY HHHHHHHHCCEEEEE | 10.82 | 21406692 | |
| 204 | Phosphorylation | QVAQASHSYRVYYNA HHHHHHCCEEEEEEC | 16.49 | 21406692 | |
| 205 | Phosphorylation | VAQASHSYRVYYNAG HHHHHCCEEEEEECC | 9.93 | 21406692 | |
| 243 | Methylation | LFTDYYGRSRSAEQI CCCCCCCCCCCHHHH | 16.87 | 30760971 | |
| 266 | Phosphorylation | AAFRSVLS------- HHHHHHHC------- | 35.70 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCO2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCO2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCO2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| VDAC3_HUMAN | VDAC3 | physical | 22939629 | |
| THY1_HUMAN | THY1 | physical | 22939629 | |
| VATE1_HUMAN | ATP6V1E1 | physical | 22939629 | |
| SEPT9_HUMAN | SEPT9 | physical | 22939629 | |
| SRPRB_HUMAN | SRPRB | physical | 22939629 | |
| SPRE_HUMAN | SPR | physical | 22939629 | |
| STX7_HUMAN | STX7 | physical | 22939629 | |
| TIAR_HUMAN | TIAL1 | physical | 22939629 | |
| STOM_HUMAN | STOM | physical | 22939629 | |
| TIM44_HUMAN | TIMM44 | physical | 22939629 | |
| SUGP1_HUMAN | SUGP1 | physical | 22939629 | |
| ZO1_HUMAN | TJP1 | physical | 22939629 | |
| UBE4B_HUMAN | UBE4B | physical | 22939629 | |
| RIDA_HUMAN | HRSP12 | physical | 22939629 | |
| COX2_HUMAN | COX2 | physical | 25959673 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 604377 | Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 1 (CEMCOX1) | |||||
| 608908 | Myopia 6 (MYP6) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...