COX2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COX2_HUMAN
• UniProt AC: P00403
• Protein Name: Cytochrome c oxidase subunit 2
• Gene Name: MT-CO2
• Organism: Homo sapiens (Human).
• Sequence Length: 227
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1..
• Protein Sequence: MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Sulfoxidation	NISDAQEMETVWTIL CCCCHHHHHHHHHHH	3.30	28183972
80	Phosphorylation	LVLIALPSLRILYMT HHHHHHCCCCHHHCC	31.00	24719451
82	Methylation	LIALPSLRILYMTDE HHHHCCCCHHHCCCC	22.62	-
86	Sulfoxidation	PSLRILYMTDEVNDP CCCCHHHCCCCCCCC	3.23	28183972
94	Phosphorylation	TDEVNDPSLTIKSIG CCCCCCCCEEEEECC	40.79	24719451
171	Ubiquitination	AVPTLGLKTDAIPGR CCCCCCCCCCCCCCC	42.43	21890473
182	Phosphorylation	IPGRLNQTTFTATRP CCCCCCCCEEEEECC	23.86	21406692
183	Phosphorylation	PGRLNQTTFTATRPG CCCCCCCEEEEECCC	14.82	21406692
185	Phosphorylation	RLNQTTFTATRPGVY CCCCCEEEEECCCEE	25.65	21406692
187	Phosphorylation	NQTTFTATRPGVYYG CCCEEEEECCCEEEE	34.05	21406692
196	S-nitrosocysteine	PGVYYGQCSEICGAN CCEEEEEHHHHCCCC	3.24	-
196	S-nitrosylation	PGVYYGQCSEICGAN CCEEEEEHHHHCCCC	3.24	22178444
200	S-nitrosocysteine	YGQCSEICGANHSFM EEEHHHHCCCCCCCH	3.55	-
200	S-nitrosylation	YGQCSEICGANHSFM EEEHHHHCCCCCCCH	3.55	22178444

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COX2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COX2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COX2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA1_HUMAN	PSMA1	physical	21988832
RIDA_HUMAN	HRSP12	physical	21988832
BAP31_HUMAN	BCAP31	physical	15254227
COX41_HUMAN	COX4I1	physical	26344197
OST48_HUMAN	DDOST	physical	26344197
MAGT1_HUMAN	MAGT1	physical	26344197
PHB_HUMAN	PHB	physical	26344197
SSRA_HUMAN	SSR1	physical	26344197
SSRD_HUMAN	SSR4	physical	26344197
QCR2_HUMAN	UQCRC2	physical	26344197
VDAC1_HUMAN	VDAC1	physical	26344197
VDAC2_HUMAN	VDAC2	physical	26344197
VDAC3_HUMAN	VDAC3	physical	26344197
STOM_HUMAN	STOM	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 220110: Mitochondrial complex IV deficiency (MT-C4D)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB02659: Cholic Acid