UniProt ID | BAP31_HUMAN | |
---|---|---|
UniProt AC | P51572 | |
Protein Name | B-cell receptor-associated protein 31 | |
Gene Name | BCAP31 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 246 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane Multi-pass membrane protein . May shuttle between the ER and the intermediate compartment/cis-Golgi complex. |
|
Protein Description | Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.. | |
Protein Sequence | MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Ubiquitination | ISPKRWQKIFKSRLV CCHHHHHHHHHHHHH | 43.05 | 27667366 | |
37 | Ubiquitination | KRWQKIFKSRLVELL HHHHHHHHHHHHHHH | 37.83 | - | |
62 | Ubiquitination | LIVILVLLVIDAVRE HHHHHHHHHHHHHHH | 2.18 | 27667366 | |
72 | Acetylation | DAVREIRKYDDVTEK HHHHHHHCCCCCHHH | 59.71 | 27452117 | |
72 | Ubiquitination | DAVREIRKYDDVTEK HHHHHHHCCCCCHHH | 59.71 | 21906983 | |
73 | Phosphorylation | AVREIRKYDDVTEKV HHHHHHCCCCCHHHC | 13.92 | - | |
79 | Ubiquitination | KYDDVTEKVNLQNNP CCCCCHHHCCCCCCC | 27.36 | 21906983 | |
95 | Acetylation | AMEHFHMKLFRAQRN HHHHHHHHHHHHHHC | 35.58 | 25825284 | |
95 | Ubiquitination | AMEHFHMKLFRAQRN HHHHHHHHHHHHHHC | 35.58 | 21906983 | |
101 | Ubiquitination | MKLFRAQRNLYIAGF HHHHHHHHCHHHHHH | 33.85 | 27667366 | |
104 | Phosphorylation | FRAQRNLYIAGFSLL HHHHHCHHHHHHHHH | 7.71 | 22210691 | |
109 | Phosphorylation | NLYIAGFSLLLSFLL CHHHHHHHHHHHHHH | 19.72 | 22210691 | |
113 | Phosphorylation | AGFSLLLSFLLRRLV HHHHHHHHHHHHHHH | 17.51 | 22210691 | |
137 | Ubiquitination | LASNEAFKKQAESAS HHCCHHHHHHHHHHH | 51.53 | 21906983 | |
138 | Ubiquitination | ASNEAFKKQAESASE HCCHHHHHHHHHHHH | 48.57 | 21906983 | |
139 | Ubiquitination | SNEAFKKQAESASEA CCHHHHHHHHHHHHH | 51.45 | 21963094 | |
146 | Ubiquitination | QAESASEAAKKYMEE HHHHHHHHHHHHHHH | 23.29 | 21963094 | |
146 | Ubiquitination | QAESASEAAKKYMEE HHHHHHHHHHHHHHH | 23.29 | 21890473 | |
146 (in isoform 2) | Ubiquitination | - | 23.29 | - | |
148 | Ubiquitination | ESASEAAKKYMEEND HHHHHHHHHHHHHCC | 52.03 | 21906983 | |
149 | Ubiquitination | SASEAAKKYMEENDQ HHHHHHHHHHHHCCH | 45.14 | 27667366 | |
149 | Acetylation | SASEAAKKYMEENDQ HHHHHHHHHHHHCCH | 45.14 | 27452117 | |
151 | Sulfoxidation | SEAAKKYMEENDQLK HHHHHHHHHHCCHHC | 7.76 | 21406390 | |
158 | Acetylation | MEENDQLKKGAAVDG HHHCCHHCCCCCCCC | 43.45 | 27452117 | |
158 | Ubiquitination | MEENDQLKKGAAVDG HHHCCHHCCCCCCCC | 43.45 | 21906983 | |
159 | Ubiquitination | EENDQLKKGAAVDGG HHCCHHCCCCCCCCC | 63.47 | 21906983 | |
162 | Ubiquitination | DQLKKGAAVDGGKLD CHHCCCCCCCCCCCC | 14.49 | 21890473 | |
162 | Ubiquitination | DQLKKGAAVDGGKLD CHHCCCCCCCCCCCC | 14.49 | 21963094 | |
162 (in isoform 2) | Ubiquitination | - | 14.49 | - | |
167 | Ubiquitination | GAAVDGGKLDVGNAE CCCCCCCCCCCCCCE | 47.22 | 21906983 | |
167 | Acetylation | GAAVDGGKLDVGNAE CCCCCCCCCCCCCCE | 47.22 | 23236377 | |
167 | Neddylation | GAAVDGGKLDVGNAE CCCCCCCCCCCCCCE | 47.22 | 32015554 | |
176 | Ubiquitination | DVGNAEVKLEEENRS CCCCCEEHHHHHHHH | 41.51 | 21906983 | |
176 | Acetylation | DVGNAEVKLEEENRS CCCCCEEHHHHHHHH | 41.51 | 23236377 | |
185 | Ubiquitination | EEENRSLKADLQKLK HHHHHHHHHHHHHHH | 40.89 | 21906983 | |
190 | Acetylation | SLKADLQKLKDELAS HHHHHHHHHHHHHHH | 65.87 | 23749302 | |
190 | Ubiquitination | SLKADLQKLKDELAS HHHHHHHHHHHHHHH | 65.87 | 27667366 | |
192 | Ubiquitination | KADLQKLKDELASTK HHHHHHHHHHHHHHH | 57.08 | 21906983 | |
197 | Phosphorylation | KLKDELASTKQKLEK HHHHHHHHHHHHHHH | 49.08 | 23911959 | |
198 | Phosphorylation | LKDELASTKQKLEKA HHHHHHHHHHHHHHH | 31.71 | 27251275 | |
199 | Ubiquitination | KDELASTKQKLEKAE HHHHHHHHHHHHHHH | 42.83 | 21906983 | |
201 | Ubiquitination | ELASTKQKLEKAENQ HHHHHHHHHHHHHHH | 61.23 | 22817900 | |
201 | Acetylation | ELASTKQKLEKAENQ HHHHHHHHHHHHHHH | 61.23 | 25953088 | |
204 | Ubiquitination | STKQKLEKAENQVLA HHHHHHHHHHHHHHH | 72.01 | 27667366 | |
204 | Acetylation | STKQKLEKAENQVLA HHHHHHHHHHHHHHH | 72.01 | 20167786 | |
205 | Ubiquitination | TKQKLEKAENQVLAM HHHHHHHHHHHHHHH | 16.17 | 27667366 | |
212 | Sulfoxidation | AENQVLAMRKQSEGL HHHHHHHHHHHCCCC | 4.87 | 21406390 | |
214 | Ubiquitination | NQVLAMRKQSEGLTK HHHHHHHHHCCCCHH | 45.12 | 33845483 | |
215 | Ubiquitination | QVLAMRKQSEGLTKE HHHHHHHHCCCCHHH | 36.03 | 27667366 | |
216 | Phosphorylation | VLAMRKQSEGLTKEY HHHHHHHCCCCHHHH | 36.35 | 23882029 | |
216 (in isoform 2) | Ubiquitination | - | 36.35 | - | |
216 | Ubiquitination | VLAMRKQSEGLTKEY HHHHHHHCCCCHHHH | 36.35 | 27667366 | |
220 | Phosphorylation | RKQSEGLTKEYDRLL HHHCCCCHHHHHHHH | 32.46 | 29514088 | |
221 | Ubiquitination | KQSEGLTKEYDRLLE HHCCCCHHHHHHHHH | 60.36 | 21906983 | |
223 | Phosphorylation | SEGLTKEYDRLLEEH CCCCHHHHHHHHHHH | 14.12 | 20068231 | |
225 (in isoform 2) | Ubiquitination | - | 40.03 | - | |
225 | Ubiquitination | GLTKEYDRLLEEHAK CCHHHHHHHHHHHHH | 40.03 | 27667366 | |
226 (in isoform 2) | Ubiquitination | - | 6.88 | - | |
226 | Ubiquitination | LTKEYDRLLEEHAKL CHHHHHHHHHHHHHH | 6.88 | 27667366 | |
232 | Ubiquitination | RLLEEHAKLQAAVDG HHHHHHHHHHHHHCC | 42.93 | 32015554 | |
234 | Neddylation | LEEHAKLQAAVDGPM HHHHHHHHHHHCCCC | 26.94 | 32015554 | |
234 | Ubiquitination | LEEHAKLQAAVDGPM HHHHHHHHHHHCCCC | 26.94 | 32142685 | |
234 (in isoform 2) | Ubiquitination | - | 26.94 | - | |
241 | Sulfoxidation | QAAVDGPMDKKEE-- HHHHCCCCCCCCC-- | 16.83 | 21406390 | |
243 | Acetylation | AVDGPMDKKEE---- HHCCCCCCCCC---- | 56.69 | 23236377 | |
243 | Ubiquitination | AVDGPMDKKEE---- HHCCCCCCCCC---- | 56.69 | 32142685 | |
243 (in isoform 2) | Ubiquitination | - | 56.69 | - | |
244 | Ubiquitination | VDGPMDKKEE----- HCCCCCCCCC----- | 63.91 | 21906983 | |
252 (in isoform 2) | Ubiquitination | - | - | ||
252 | Ubiquitination | EE------------- CC------------- | 27667366 | ||
257 (in isoform 2) | Ubiquitination | - | - | ||
257 | Ubiquitination | ------------------ ------------------ | 27667366 | ||
259 (in isoform 2) | Ubiquitination | - | - | ||
259 | Ubiquitination | -------------------- -------------------- | 22817900 | ||
264 | Phosphorylation | ------------------------- ------------------------- | 27251275 | ||
266 | Acetylation | --------------------------- --------------------------- | - | ||
266 | Ubiquitination | --------------------------- --------------------------- | 22817900 | ||
268 | Ubiquitination | ----------------------------- ----------------------------- | 22817900 | ||
271 (in isoform 2) | Ubiquitination | - | - | ||
271 | Ubiquitination | -------------------------------- -------------------------------- | 21890473 | ||
271 | Ubiquitination | -------------------------------- -------------------------------- | 27667366 | ||
281 | Ubiquitination | ------------------------------------------ ------------------------------------------ | 33845483 | ||
283 | Phosphorylation | -------------------------------------------- -------------------------------------------- | 24719451 | ||
288 (in isoform 2) | Ubiquitination | - | - | ||
288 | Ubiquitination | ------------------------------------------------- ------------------------------------------------- | 27667366 | ||
290 | Phosphorylation | --------------------------------------------------- --------------------------------------------------- | - | ||
299 | Ubiquitination | ------------------------------------------------------------ ------------------------------------------------------------ | 32015554 | ||
310 (in isoform 2) | Ubiquitination | - | - | ||
310 | Ubiquitination | ----------------------------------------------------------------------- ----------------------------------------------------------------------- | 27667366 | ||
311 (in isoform 2) | Ubiquitination | - | - | ||
311 | Ubiquitination | ------------------------------------------------------------------------ ------------------------------------------------------------------------ | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BAP31_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAP31_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAP31_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
300475 | Deafness, dystonia, and cerebral hypomyelination (DDCH) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...