VAMP3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VAMP3_HUMAN
• UniProt AC: Q15836
• Protein Name: Vesicle-associated membrane protein 3
• Gene Name: VAMP3
• Organism: Homo sapiens (Human).
• Sequence Length: 100
• Subcellular Localization: Membrane ; Single-pass type IV membrane protein . Cell junction, synapse, synaptosome.
• Protein Description: SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network..
• Protein Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTGPTAAT ------CCCCCCCCC	41.91	29255136
2	Acetylation	------MSTGPTAAT ------CCCCCCCCC	41.91	25944712
3	Phosphorylation	-----MSTGPTAATG -----CCCCCCCCCC	45.97	29255136
6	Phosphorylation	--MSTGPTAATGSNR --CCCCCCCCCCCHH	30.21	29255136
9	Phosphorylation	STGPTAATGSNRRLQ CCCCCCCCCCHHHHH	38.38	29255136
11	Phosphorylation	GPTAATGSNRRLQQT CCCCCCCCHHHHHHH	23.86	29255136
18	Phosphorylation	SNRRLQQTQNQVDEV CHHHHHHHHHHHHHH	19.27	28555341
29	Sulfoxidation	VDEVVDIMRVNVDKV HHHHHHHHCCCHHHH	3.20	21406390
35	Ubiquitination	IMRVNVDKVLERDQK HHCCCHHHHHHHHHH	44.42	21890473
35	2-Hydroxyisobutyrylation	IMRVNVDKVLERDQK HHCCCHHHHHHHHHH	44.42	-
42	Ubiquitination	KVLERDQKLSELDDR HHHHHHHHHHHHHHH	59.26	21890473
44	Phosphorylation	LERDQKLSELDDRAD HHHHHHHHHHHHHHH	43.05	23401153
49	Methylation	KLSELDDRADALQAG HHHHHHHHHHHHHHH	33.75	-
58	Phosphorylation	DALQAGASQFETSAA HHHHHHHHHHHHHHH	34.19	23401153
62	Phosphorylation	AGASQFETSAAKLKR HHHHHHHHHHHHHHH	25.59	30266825
63	Phosphorylation	GASQFETSAAKLKRK HHHHHHHHHHHHHHH	21.02	19664994
66	Ubiquitination	QFETSAAKLKRKYWW HHHHHHHHHHHHHHH	55.01	21890473
66	Ubiquitination	QFETSAAKLKRKYWW HHHHHHHHHHHHHHH	55.01	21890473
68	Ubiquitination	ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH	46.25	21890473
68	Ubiquitination	ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH	46.25	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RNF130	Q86XS8	PMID:23353890

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VAMP3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VAMP3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STX6_HUMAN	STX6	physical	11839770
VTI1A_HUMAN	VTI1A	physical	11839770
BAP31_HUMAN	BCAP31	physical	9396746
VAMP8_HUMAN	VAMP8	physical	12130530
A4_HUMAN	APP	physical	21832049
B2L13_HUMAN	BCL2L13	physical	25416956
STX6_HUMAN	STX6	physical	19557002
STX7_HUMAN	STX7	physical	19557002
STX8_HUMAN	STX8	physical	19557002
STX3_HUMAN	STX3	physical	26553929
RB11A_HUMAN	RAB11A	physical	26553929
RAB8A_HUMAN	RAB8A	physical	26553929

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage.";
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
Science 316:1160-1166(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-58, AND MASSSPECTROMETRY.
PubMed: 17525332