UniProt ID | BFAR_HUMAN | |
---|---|---|
UniProt AC | Q9NZS9 | |
Protein Name | Bifunctional apoptosis regulator | |
Gene Name | BFAR | |
Organism | Homo sapiens (Human). | |
Sequence Length | 450 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Apoptosis regulator. Has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.. | |
Protein Sequence | MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCNCLFYWALYFNPIINIDLVVKELRRLETQVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MEEPQKSYVNTMDLE CCCCCCHHCCCCCCC | 12.54 | 22817900 | |
68 | Phosphorylation | WWASSKKTECPECRE HHHHCCCCCCHHHHH | 46.70 | 28509920 | |
76 | Ubiquitination | ECPECREKWEGFPKV CCHHHHHHCCCCCHH | 31.06 | - | |
82 | Ubiquitination | EKWEGFPKVSILLRD HHCCCCCHHHHHHHH | 46.48 | 21890473 | |
84 | Phosphorylation | WEGFPKVSILLRDAI CCCCCHHHHHHHHHH | 17.41 | 22210691 | |
93 | Ubiquitination | LLRDAIEKLFPDAIR HHHHHHHHHCCHHHH | 49.68 | - | |
97 | Ubiquitination | AIEKLFPDAIRLRFE HHHHHCCHHHHHHHH | 47.49 | 21890473 | |
119 | Ubiquitination | IVQSLAAFQKYGNDQ HHHHHHHHHHHCCCC | 5.53 | 21890473 | |
121 | Ubiquitination | QSLAAFQKYGNDQIP HHHHHHHHHCCCCCC | 48.98 | 21906983 | |
124 | Ubiquitination | AAFQKYGNDQIPLAP HHHHHHCCCCCCCCC | 34.62 | 21890473 | |
133 | Ubiquitination | QIPLAPNTGRANQQM CCCCCCCCCCCCCCC | 27.30 | 21890473 | |
177 | Ubiquitination | EHDLLVHKAVAKWTA HHHHHHHHHHHHCCH | 36.76 | - | |
194 | Ubiquitination | VVLWLEQLGPWASLY HHHHHHHHHHHHHHH | 6.94 | 21890473 | |
199 | Ubiquitination | EQLGPWASLYRERFL HHHHHHHHHHHHHHH | 23.28 | 21890473 | |
225 | Ubiquitination | LTEEEFSKTPYTIEN EEHHHHCCCCCCCCC | 59.86 | 21890473 | |
232 | N-linked_Glycosylation | KTPYTIENSSHRRAI CCCCCCCCCHHHHHH | 44.99 | UniProtKB CARBOHYD | |
247 | Ubiquitination | LMELERVKALGVKPP HHHHHHHHHCCCCCC | 44.08 | 21890473 | |
252 | Ubiquitination | RVKALGVKPPQNLWE HHHHCCCCCCCCHHE | 49.54 | 21890473 | |
259 | Ubiquitination | KPPQNLWEYKAVNPG CCCCCHHEEEECCCC | 40.08 | - | |
261 | Ubiquitination | PQNLWEYKAVNPGRS CCCHHEEEECCCCCH | 34.05 | 21890473 | |
322 | Ubiquitination | VTKLLDLKEPTWKQW HHHHHCCCCCCHHHH | 62.40 | 21890473 | |
327 | Ubiquitination | DLKEPTWKQWREFLV CCCCCCHHHHHHHHH | 42.32 | 21890473 | |
376 | Phosphorylation | LSVLELFSFWRIWSR HHHHHHHHHHHHHCH | 36.20 | 22817900 | |
387 | Ubiquitination | IWSRSELKTVPQRMW HHCHHHHCCCCHHHH | 43.34 | 2190698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BFAR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BFAR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BFAR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC_HUMAN | UBC | physical | 21068390 | |
BI1_HUMAN | TMBIM6 | physical | 21068390 | |
UB2G2_MOUSE | Ube2g2 | physical | 21068390 | |
BCL2_HUMAN | BCL2 | physical | 10716992 | |
B2CL1_HUMAN | BCL2L1 | physical | 10716992 | |
CASP8_HUMAN | CASP8 | physical | 10716992 | |
CASPA_HUMAN | CASP10 | physical | 10716992 | |
UB2D2_HUMAN | UBE2D2 | physical | 21068390 | |
TNR16_HUMAN | NGFR | physical | 22566094 | |
UB2D3_HUMAN | UBE2D3 | physical | 21068390 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-376, AND MASSSPECTROMETRY. |