UniProt ID | UB2G2_MOUSE | |
---|---|---|
UniProt AC | P60605 | |
Protein Name | Ubiquitin-conjugating enzyme E2 G2 | |
Gene Name | Ube2g2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 165 | |
Subcellular Localization | ||
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD).. | |
Protein Sequence | MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGTALKRL ------CCHHHHHHH | 24.84 | - | |
89 | Glutathionylation | IYPDGRVCISILHAP CCCCCCEEEEEEECC | 1.62 | 24333276 | |
106 | Phosphorylation | DPMGYESSAERWSPV CCCCCCCCCCCCCCC | 23.39 | - | |
153 | Ubiquitination | DDREQFYKIAKQIVQ HHHHHHHHHHHHHHH | 37.16 | - | |
156 | Ubiquitination | EQFYKIAKQIVQKSL HHHHHHHHHHHHHHH | 43.99 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2G2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2G2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2G2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AMFR_HUMAN | AMFR | physical | 11724934 | |
HRD1_YEAST | HRD1 | physical | 11724934 | |
UB2G2_MOUSE | Ube2g2 | physical | 17310145 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...