UniProt ID | BI1_HUMAN | |
---|---|---|
UniProt AC | P55061 | |
Protein Name | Bax inhibitor 1 | |
Gene Name | TMBIM6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 237 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Suppressor of apoptosis. [PubMed: 21075086 Modulates unfolded protein response signaling] | |
Protein Sequence | MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MNIFDRKINFDALL -CCCHHCCCCHHHHH | 43.79 | 18781797 | |
15 | Ubiquitination | INFDALLKFSHITPS CCHHHHHHHCCCCHH | 45.75 | 21906983 | |
28 | 2-Hydroxyisobutyrylation | PSTQQHLKKVYASFA HHHHHHHHHHHHHHH | 37.76 | - | |
28 | Ubiquitination | PSTQQHLKKVYASFA HHHHHHHHHHHHHHH | 37.76 | 21906983 | |
65 | Ubiquitination | LLSALGSLILMIWLM HHHHHHHHHHHHHHH | 3.11 | - | |
73 | Ubiquitination | ILMIWLMATPHSHET HHHHHHHHCCCCCHH | 18.79 | - | |
86 | Ubiquitination | ETEQKRLGLLAGFAF HHHHHHHHHHHHHHH | 23.76 | - | |
87 | Ubiquitination | TEQKRLGLLAGFAFL HHHHHHHHHHHHHHH | 3.33 | - | |
230 | Ubiquitination | MILAMNEKDKKKEKK HHHHHCHHHHHHHCC | 70.60 | 21906983 | |
288 | Ubiquitination | ---------------------------------------------------------- ---------------------------------------------------------- | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BI1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BI1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BCL2_HUMAN | BCL2 | physical | 9660918 | |
BFAR_HUMAN | BFAR | physical | 21068390 | |
VTI1A_HUMAN | VTI1A | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...