UniProt ID | UB2D2_HUMAN | |
---|---|---|
UniProt AC | P62837 | |
Protein Name | Ubiquitin-conjugating enzyme E2 D2 | |
Gene Name | UBE2D2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.. | |
Protein Sequence | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Acetylation | MALKRIHKELNDLAR CCHHHHHHHHHHHHH | 62.62 | 21791702 | |
8 | Ubiquitination | MALKRIHKELNDLAR CCHHHHHHHHHHHHH | 62.62 | 33845483 | |
74 | Phosphorylation | VAFTTRIYHPNINSN EEEEEEEECCCCCCC | 14.13 | 28152594 | |
80 | Phosphorylation | IYHPNINSNGSICLD EECCCCCCCCEEHHH | 38.48 | 24076635 | |
83 | Phosphorylation | PNINSNGSICLDILR CCCCCCCEEHHHHHH | 17.87 | 25849741 | |
94 | Phosphorylation | DILRSQWSPALTISK HHHHHCCCCCHHHHH | 7.83 | - | |
98 | Phosphorylation | SQWSPALTISKVLLS HCCCCCHHHHHHHHH | 25.88 | 21712546 | |
101 | Ubiquitination | SPALTISKVLLSICS CCCHHHHHHHHHHHH | 32.81 | - | |
105 | Phosphorylation | TISKVLLSICSLLCD HHHHHHHHHHHHHCC | 19.86 | - | |
115 | Ubiquitination | SLLCDPNPDDPLVPE HHHCCCCCCCCCHHH | 53.41 | 21963094 | |
115 | Acetylation | SLLCDPNPDDPLVPE HHHCCCCCCCCCHHH | 53.41 | 19608861 | |
128 | Ubiquitination | PEIARIYKTDREKYN HHHHHHHHHCHHHHH | 41.39 | - | |
144 | Acetylation | IAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | 21791702 | |
144 | Ubiquitination | IAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | 21963094 | |
145 | Phosphorylation | AREWTQKYAM----- HHHHHHHHCC----- | 9.70 | 20736484 | |
170 | Ubiquitination | ------------------------------ ------------------------------ | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2D2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2D2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2D2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-8, AND MASS SPECTROMETRY. |