RN125_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RN125_HUMAN
• UniProt AC: Q96EQ8
• Protein Name: E3 ubiquitin-protein ligase RNF125 {ECO:0000305}
• Gene Name: RNF125 {ECO:0000312|HGNC:HGNC:21150}
• Organism: Homo sapiens (Human).
• Sequence Length: 232
• Subcellular Localization: Golgi apparatus membrane ; Lipid-anchor . Shows a reticular staining pattern within the cell and is probably expressed at other intracellular membranes in addition to the Golgi membrane. Not detected at the plasma membrane.
• Protein Description: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as DDX58/RIG-I, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53. [PubMed: 15843525]
• Protein Sequence: MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGSVLSTDS ------CCCCCCCCC	26.85	17990982
3	Phosphorylation	-----MGSVLSTDSG -----CCCCCCCCCC	20.70	24719451
7	Phosphorylation	-MGSVLSTDSGKSAP -CCCCCCCCCCCCCC	29.98	29759185
9	Phosphorylation	GSVLSTDSGKSAPAS CCCCCCCCCCCCCCH	48.48	29759185
66	Ubiquitination	SCIATSLKNNKWTCP HHHHHHHHCCCEECC	59.24	21963094
69	Ubiquitination	ATSLKNNKWTCPYCR HHHHHCCCEECCCHH	53.96	22817900
91	Ubiquitination	VPATDVAKRMKSEYK CCHHHHHHHHHHHHC	53.53	21906983
94	Ubiquitination	TDVAKRMKSEYKNCA HHHHHHHHHHHCCHH	44.14	22817900
95	Phosphorylation	DVAKRMKSEYKNCAE HHHHHHHHHHCCHHH	36.49	27251275
97	Phosphorylation	AKRMKSEYKNCAECD HHHHHHHHCCHHHCC	18.00	27251275
98	Ubiquitination	KRMKSEYKNCAECDT HHHHHHHCCHHHCCH	41.31	-
110	Phosphorylation	CDTLVCLSEMRAHIR CCHHHHHHHHHHHHH	24.99	27251275
118	Phosphorylation	EMRAHIRTCQKYIDK HHHHHHHHHHHHHHH	20.77	29083192
121	Ubiquitination	AHIRTCQKYIDKYGP HHHHHHHHHHHHHCC	46.44	22817900
122	Phosphorylation	HIRTCQKYIDKYGPL HHHHHHHHHHHHCCH	6.62	29083192
125	Ubiquitination	TCQKYIDKYGPLQEL HHHHHHHHHCCHHHH	42.42	22817900
126	Phosphorylation	CQKYIDKYGPLQELE HHHHHHHHCCHHHHH	21.89	29083192
135	Phosphorylation	PLQELEETAARCVCP CHHHHHHHHHHHHCH	19.08	29083192

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RN125_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RN125_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RN125_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC_HUMAN	UBC	physical	17990982
PML_HUMAN	PML	physical	22493164
CHFR_HUMAN	CHFR	physical	22493164
RN125_HUMAN	RNF125	physical	21571784
JAK1_HUMAN	JAK1	physical	26027934
P53_HUMAN	TP53	physical	25591766
TRI14_HUMAN	TRIM14	physical	28476934
RN125_HUMAN	RNF125	physical	27411375
UB2D1_HUMAN	UBE2D1	physical	27411375
ILRL2_HUMAN	IL1RL2	physical	29176319

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 616260: Tenorio syndrome (TNORS)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.