| UniProt ID | TRI43_HUMAN | |
|---|---|---|
| UniProt AC | Q96BQ3 | |
| Protein Name | Tripartite motif-containing protein 43 | |
| Gene Name | TRIM43 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 446 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEAQSPANCPACREPSPKMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRQTKKMFCDMDKSLLCLLCSNSQEHGAHKHHPIEEAAEEHREKLLKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKPDVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVYRLNRFRVEISFHFEVTNHNIRLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWALGVCNNSWIRKNSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVTKSSLIWSYPAGSLTFPVRPFFYTGHR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRI43_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRI43_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRI43_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TRI27_HUMAN | TRIM27 | physical | 22493164 | |
| TRIM8_HUMAN | TRIM8 | physical | 22493164 | |
| DHRS4_HUMAN | DHRS4 | physical | 28514442 | |
| CH60_HUMAN | HSPD1 | physical | 28514442 | |
| SIR3_HUMAN | SIRT3 | physical | 28514442 | |
| MIPEP_HUMAN | MIPEP | physical | 28514442 | |
| IF2M_HUMAN | MTIF2 | physical | 28514442 | |
| CLPX_HUMAN | CLPX | physical | 28514442 | |
| CLPP_HUMAN | CLPP | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...