UniProt ID | TRI50_HUMAN | |
---|---|---|
UniProt AC | Q86XT4 | |
Protein Name | E3 ubiquitin-protein ligase TRIM50 | |
Gene Name | TRIM50 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 487 | |
Subcellular Localization | Cytoplasm . Localizes mainly into discrete cytoplasmic punctuate structures heterogeneous in size and shape containing polyubiquitinated proteins. | |
Protein Description | E3 ubiquitin-protein ligase that ubiquitinates Beclin-1/BECN1 in a 'Lys-63'-dependent manner enhancing its binding to ULK1. In turn, promotes starvation-induced autophagy activation. Interacts also with p62/SQSTM1 protein and thereby induces the formation and the autophagy clearance of aggresome-associated polyubiquitinated proteins through HDAC6 interaction.. | |
Protein Sequence | MAWQVSLLELEDWLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAVDGSSSLPNVSLARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVYSRMKEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELHHLVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHKFIRKFHSMASRAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSDWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHYEQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLSPEQPTKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
267 | Phosphorylation | EGAFSPISFKPGLHQ CCCCCCCCCCCCCCH | 30.51 | 24719451 | |
327 | Phosphorylation | LLAQRRASQPERFDY HHHHHCCCCCCCCCH | 44.44 | - | |
373 | Acetylation | IKGTASRKGKLNRSP EEECCCCCCCCCCCC | 58.88 | 63828007 | |
463 | Phosphorylation | TCWHERGSNSLPMVL CCCCCCCCCCCCEEC | 29.48 | 28634298 | |
465 | Phosphorylation | WHERGSNSLPMVLPP CCCCCCCCCCEECCC | 35.23 | 28634298 | |
474 | Phosphorylation | PMVLPPPSGPGPLSP CEECCCCCCCCCCCC | 64.49 | 28634298 | |
480 | Phosphorylation | PSGPGPLSPEQPTKL CCCCCCCCCCCCCCC | 29.53 | 28634298 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRI50_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRI50_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRI50_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UB2D1_HUMAN | UBE2D1 | physical | 21143188 | |
UB2D2_HUMAN | UBE2D2 | physical | 21143188 | |
UB2D3_HUMAN | UBE2D3 | physical | 21143188 | |
UB2E1_HUMAN | UBE2E1 | physical | 21143188 | |
UB2E2_HUMAN | UBE2E2 | physical | 21143188 | |
UB2E3_HUMAN | UBE2E3 | physical | 21143188 | |
UBE2N_HUMAN | UBE2N | physical | 21143188 | |
UB2D4_HUMAN | UBE2D4 | physical | 21143188 | |
HDAC6_HUMAN | HDAC6 | physical | 22792322 | |
SQSTM_HUMAN | SQSTM1 | physical | 22792322 | |
ACK1_HUMAN | TNK2 | physical | 24308962 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...