| UniProt ID | TRI50_HUMAN | |
|---|---|---|
| UniProt AC | Q86XT4 | |
| Protein Name | E3 ubiquitin-protein ligase TRIM50 | |
| Gene Name | TRIM50 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 487 | |
| Subcellular Localization | Cytoplasm . Localizes mainly into discrete cytoplasmic punctuate structures heterogeneous in size and shape containing polyubiquitinated proteins. | |
| Protein Description | E3 ubiquitin-protein ligase that ubiquitinates Beclin-1/BECN1 in a 'Lys-63'-dependent manner enhancing its binding to ULK1. In turn, promotes starvation-induced autophagy activation. Interacts also with p62/SQSTM1 protein and thereby induces the formation and the autophagy clearance of aggresome-associated polyubiquitinated proteins through HDAC6 interaction.. | |
| Protein Sequence | MAWQVSLLELEDWLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAVDGSSSLPNVSLARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVYSRMKEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELHHLVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHKFIRKFHSMASRAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSDWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHYEQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLSPEQPTKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 267 | Phosphorylation | EGAFSPISFKPGLHQ CCCCCCCCCCCCCCH | 30.51 | 24719451 | |
| 327 | Phosphorylation | LLAQRRASQPERFDY HHHHHCCCCCCCCCH | 44.44 | - | |
| 373 | Acetylation | IKGTASRKGKLNRSP EEECCCCCCCCCCCC | 58.88 | 63828007 | |
| 463 | Phosphorylation | TCWHERGSNSLPMVL CCCCCCCCCCCCEEC | 29.48 | 28634298 | |
| 465 | Phosphorylation | WHERGSNSLPMVLPP CCCCCCCCCCEECCC | 35.23 | 28634298 | |
| 474 | Phosphorylation | PMVLPPPSGPGPLSP CEECCCCCCCCCCCC | 64.49 | 28634298 | |
| 480 | Phosphorylation | PSGPGPLSPEQPTKL CCCCCCCCCCCCCCC | 29.53 | 28634298 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRI50_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRI50_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRI50_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UB2D1_HUMAN | UBE2D1 | physical | 21143188 | |
| UB2D2_HUMAN | UBE2D2 | physical | 21143188 | |
| UB2D3_HUMAN | UBE2D3 | physical | 21143188 | |
| UB2E1_HUMAN | UBE2E1 | physical | 21143188 | |
| UB2E2_HUMAN | UBE2E2 | physical | 21143188 | |
| UB2E3_HUMAN | UBE2E3 | physical | 21143188 | |
| UBE2N_HUMAN | UBE2N | physical | 21143188 | |
| UB2D4_HUMAN | UBE2D4 | physical | 21143188 | |
| HDAC6_HUMAN | HDAC6 | physical | 22792322 | |
| SQSTM_HUMAN | SQSTM1 | physical | 22792322 | |
| ACK1_HUMAN | TNK2 | physical | 24308962 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
