UniProt ID | UB2E2_HUMAN | |
---|---|---|
UniProt AC | Q96LR5 | |
Protein Name | Ubiquitin-conjugating enzyme E2 E2 | |
Gene Name | UBE2E2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 201 | |
Subcellular Localization | ||
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.. | |
Protein Sequence | MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSTEAQRVD ------CCCCCCCCC | 34.65 | 19413330 | |
2 | Phosphorylation | ------MSTEAQRVD ------CCCCCCCCC | 34.65 | 23090842 | |
3 | Phosphorylation | -----MSTEAQRVDD -----CCCCCCCCCC | 33.76 | 23090842 | |
11 | Phosphorylation | EAQRVDDSPSTSGGS CCCCCCCCCCCCCCC | 19.11 | 23927012 | |
13 | Phosphorylation | QRVDDSPSTSGGSSD CCCCCCCCCCCCCCC | 38.87 | 23927012 | |
14 | Phosphorylation | RVDDSPSTSGGSSDG CCCCCCCCCCCCCCH | 34.47 | 23927012 | |
15 | Phosphorylation | VDDSPSTSGGSSDGD CCCCCCCCCCCCCHH | 45.56 | 30278072 | |
18 | Phosphorylation | SPSTSGGSSDGDQRE CCCCCCCCCCHHHHH | 28.87 | 30278072 | |
19 | Phosphorylation | PSTSGGSSDGDQRES CCCCCCCCCHHHHHH | 49.22 | 30278072 | |
26 | Phosphorylation | SDGDQRESVQQEPER CCHHHHHHHHCCCHH | 27.67 | 30108239 | |
44 | "N6,N6-dimethyllysine" | QPKKKEGKISSKTAA CCCCCCCCCCHHHHH | 40.27 | - | |
44 | Methylation | QPKKKEGKISSKTAA CCCCCCCCCCHHHHH | 40.27 | - | |
48 | Acetylation | KEGKISSKTAAKLST CCCCCCHHHHHHHHH | 35.08 | 20167786 | |
49 | Phosphorylation | EGKISSKTAAKLSTS CCCCCHHHHHHHHHH | 33.52 | 27251275 | |
52 | Methylation | ISSKTAAKLSTSAKR CCHHHHHHHHHHHHH | 40.27 | - | |
52 | Acetylation | ISSKTAAKLSTSAKR CCHHHHHHHHHHHHH | 40.27 | 25953088 | |
52 | "N6,N6-dimethyllysine" | ISSKTAAKLSTSAKR CCHHHHHHHHHHHHH | 40.27 | - | |
54 | Phosphorylation | SKTAAKLSTSAKRIQ HHHHHHHHHHHHHHH | 21.43 | 27251275 | |
55 | Phosphorylation | KTAAKLSTSAKRIQK HHHHHHHHHHHHHHH | 43.04 | 28348404 | |
56 | Phosphorylation | TAAKLSTSAKRIQKE HHHHHHHHHHHHHHH | 28.54 | 30177828 | |
58 | Ubiquitination | AKLSTSAKRIQKELA HHHHHHHHHHHHHHH | 50.21 | 23000965 | |
62 | Ubiquitination | TSAKRIQKELAEITL HHHHHHHHHHHHCCC | 52.93 | 23000965 | |
80 | Ubiquitination | PNCSAGPKGDNIYEW CCCCCCCCCCCEEEE | 77.35 | 21963094 | |
85 | Phosphorylation | GPKGDNIYEWRSTIL CCCCCCEEEECCCEE | 18.72 | 28152594 | |
144 | Ubiquitination | VICLDILKDNWSPAL EEEEEHHCCCCCCCH | 49.72 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2E2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2E2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2E2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19, AND MASSSPECTROMETRY. |