UniProt ID | PRKN_HUMAN | |
---|---|---|
UniProt AC | O60260 | |
Protein Name | E3 ubiquitin-protein ligase parkin {ECO:0000305} | |
Gene Name | PRKN {ECO:0000312|HGNC:HGNC:8607} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 465 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus. Endoplasmic reticulum. Mitochondrion . Mainly localizes in the cytosol. Co-localizes with SYT11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. Mitochondrial localization gradually increases with cellula | |
Protein Description | Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins, such as BCL2, SYT11, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPT5, TOMM20, USP30, ZNF746 and AIMP2. [PubMed: 10973942] | |
Protein Sequence | MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | IVFVRFNSSHGFPVE EEEEEEECCCCCEEE | - | ||
10 | Phosphorylation | VFVRFNSSHGFPVEV EEEEEECCCCCEEEE | - | ||
19 | Phosphorylation | GFPVEVDSDTSIFQL CCEEEECCCCCEEEH | - | ||
27 (in isoform 2) | Ubiquitination | - | - | ||
27 | Ubiquitination | DTSIFQLKEVVAKRQ CCCEEEHHHHHHHHC | - | ||
48 (in isoform 2) | Ubiquitination | - | - | ||
48 | Ubiquitination | LRVIFAGKELRNDWT EEEEEECCCCCCCCE | - | ||
65 | Phosphorylation | NCDLDQQSIVHIVQR CCCCCHHHEEEEECC | 19229105 | ||
76 (in isoform 2) | Ubiquitination | - | - | ||
76 | Ubiquitination | IVQRPWRKGQEMNAT EECCCCCCCCCCCCC | - | ||
83 | Phosphorylation | KGQEMNATGGDDPRN CCCCCCCCCCCCCCC | 22468782 | ||
101 | Phosphorylation | GCEREPQSLTRVDLS CCCCCCCCCEEEECC | 22817900 | ||
108 | Phosphorylation | SLTRVDLSSSVLPGD CCEEEECCCCCCCCC | - | ||
116 | Phosphorylation | SSVLPGDSVGLAVIL CCCCCCCCEEEEEEE | - | ||
129 (in isoform 2) | Ubiquitination | - | - | ||
131 | Phosphorylation | HTDSRKDSPPAGSPA ECCCCCCCCCCCCCC | 22817900 | ||
136 | Phosphorylation | KDSPPAGSPAGRSIY CCCCCCCCCCHHHCC | 22817900 | ||
143 | Phosphorylation | SPAGRSIYNSFYVYC CCCHHHCCCEEEEEE | 20823226 | ||
175 | Phosphorylation | TCRQATLTLTQGPSC CCCCEEEEECCCCCC | 18957282 | ||
193 | Phosphorylation | VLIPNRMSGECQSPH EEECCCCCCCCCCCC | - | ||
198 | Phosphorylation | RMSGECQSPHCPGTS CCCCCCCCCCCCCCC | - | ||
204 | Phosphorylation | QSPHCPGTSAEFFFK CCCCCCCCCEEEEEE | - | ||
217 | Phosphorylation | FKCGAHPTSDKETSV EECCCCCCCCCHHHH | 18957282 | ||
246 | Phosphorylation | ITCTDVRSPVLVFQC EEECCCCCCEEEEEC | 23532336 | ||
296 | Phosphorylation | CVAGCPNSLIKELHH CCCCCCCHHHHHHHH | 22817900 | ||
372 | Phosphorylation | CRECKEAYHEGECSA EHHHHHHHHCCCCCE | - | ||
378 | Phosphorylation | AYHEGECSAVFEASG HHHCCCCCEEEEECC | 22817900 | ||
380 (in isoform 2) | Ubiquitination | - | - | ||
384 (in isoform 2) | Ubiquitination | - | - | ||
388 | Phosphorylation | FEASGTTTQAYRVDE EEECCCCCEEEECCH | - | ||
391 | Phosphorylation | SGTTTQAYRVDERAA CCCCCEEEECCHHHH | - | ||
408 | Ubiquitination | ARWEAASKETIKKTT HHHHHHCHHHHHHCC | - | ||
412 | Ubiquitination | AASKETIKKTTKPCP HHCHHHHHHCCCCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
65 | S | Phosphorylation | Kinase | PINK1 | Q9BXM7 | Uniprot |
101 | S | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
131 | S | Phosphorylation | Kinase | CDK5 | Q00535 | PSP |
143 | Y | Phosphorylation | Kinase | ABL1 | P00519 | GPS |
378 | S | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
378 | S | Phosphorylation | Kinase | PLK1 | P53350 | PSP |
- | K | Ubiquitination | E3 ubiquitin ligase | RNF41 | Q9H4P4 | PMID:15632191 |
- | K | Ubiquitination | E3 ubiquitin ligase | PRKN | O60260 | PMID:15252205 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRKN_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...