GSDMA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GSDMA_HUMAN
• UniProt AC: Q96QA5
• Protein Name: Gasdermin-A
• Gene Name: GSDMA
• Organism: Homo sapiens (Human).
• Sequence Length: 445
• Subcellular Localization: Cytoplasm, perinuclear region . Cytoplasm, cytosol . Cell membrane .
• Protein Description: May promote pyroptosis (Probable). Upon cleavage in vitro of genetically engineered GSDMA, the released N-terminal moiety binds to some types of lipids, such as possibly phosphatidylinositol (4,5)-bisphosphate. Homooligomerizes within the membrane and forms pores of 10 -15 nanometers (nm) of inner diameter, triggering cell death. Also binds to bacterial and mitochondrial lipids, including cardiolipin, and exhibits bactericidal activity. [PubMed: 27281216 The physiological relevance of these observations is unknown (Probable]
• Protein Sequence: MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTMFENVTR ------CCHHHHHHH	30.48	20860994
8	Phosphorylation	MTMFENVTRALARQL CCHHHHHHHHHHHHH	23.08	20860994
98	Phosphorylation	GDVDVPKTVKVKGTA CCCCCCCEEEEECCC	21.35	20068231
112	Phosphorylation	AGLSQNSTLEVQTLS CCCCCCCCEEEEEEE	34.19	-
196	Phosphorylation	INHKEAVTIPKGCVL CCCCCCCCCCCCCEE	38.31	19664994
268	Phosphorylation	KEEVQRETQQVEKLS HHHHHHHHHHHHHHH	26.87	30622161
280	Phosphorylation	KLSRVGQSSLLSSLS HHHHHCHHHHHHHHH	19.61	26270265
281	Phosphorylation	LSRVGQSSLLSSLSK HHHHCHHHHHHHHHH	25.99	26270265
284	Phosphorylation	VGQSSLLSSLSKLLG HCHHHHHHHHHHHHC	34.23	26270265
285	Phosphorylation	GQSSLLSSLSKLLGK CHHHHHHHHHHHHCC	36.31	26270265
287	Phosphorylation	SSLLSSLSKLLGKKK HHHHHHHHHHHCCCH	24.17	26270265
314	Phosphorylation	LDKGHEVTLEALPKD HHCCCEEEHHHCCHH	18.85	30576142
325	Phosphorylation	LPKDVLLSKEAVGAI CCHHHHCCHHHHHHH	25.04	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GSDMA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GSDMA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
8	Phosphorylation	18 (10)	R ⇒ Q	rs3894194	Systemic sclerosis Asthma	28314753 20860503 24241537

Protein-Protein Interaction

Oops, there are no PPI records of GSDMA_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.