UniProt ID | RFC4_HUMAN | |
---|---|---|
UniProt AC | P35249 | |
Protein Name | Replication factor C subunit 4 | |
Gene Name | RFC4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 363 | |
Subcellular Localization | Nucleus . | |
Protein Description | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.. | |
Protein Sequence | MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MQAFLKGT -------CCCCCCCC | 6.14 | 22814378 | |
6 | Methylation | --MQAFLKGTSISTK --CCCCCCCCCCCCC | 54.40 | 22636065 | |
6 | Ubiquitination | --MQAFLKGTSISTK --CCCCCCCCCCCCC | 54.40 | 19608861 | |
6 | Acetylation | --MQAFLKGTSISTK --CCCCCCCCCCCCC | 54.40 | 19608861 | |
8 | Phosphorylation | MQAFLKGTSISTKPP CCCCCCCCCCCCCCC | 22.69 | 20068231 | |
9 | Phosphorylation | QAFLKGTSISTKPPL CCCCCCCCCCCCCCC | 24.18 | 20068231 | |
11 | Phosphorylation | FLKGTSISTKPPLTK CCCCCCCCCCCCCCC | 30.10 | 20068231 | |
12 | Phosphorylation | LKGTSISTKPPLTKD CCCCCCCCCCCCCCC | 45.99 | 20068231 | |
13 | Acetylation | KGTSISTKPPLTKDR CCCCCCCCCCCCCCC | 37.54 | 19608861 | |
13 | Ubiquitination | KGTSISTKPPLTKDR CCCCCCCCCCCCCCC | 37.54 | 24816145 | |
17 | Phosphorylation | ISTKPPLTKDRGVAA CCCCCCCCCCCCCCC | 36.35 | 20068231 | |
18 | Ubiquitination | STKPPLTKDRGVAAS CCCCCCCCCCCCCCC | 53.78 | 32015554 | |
20 | Methylation | KPPLTKDRGVAASAG CCCCCCCCCCCCCCC | 42.94 | 115491183 | |
25 | Phosphorylation | KDRGVAASAGSSGEN CCCCCCCCCCCCCCC | 24.35 | 20068231 | |
28 | Phosphorylation | GVAASAGSSGENKKA CCCCCCCCCCCCCCC | 34.58 | 25159151 | |
29 | Phosphorylation | VAASAGSSGENKKAK CCCCCCCCCCCCCCC | 49.56 | 25159151 | |
33 | Acetylation | AGSSGENKKAKPVPW CCCCCCCCCCCCCCC | 50.21 | 25953088 | |
34 | Ubiquitination | GSSGENKKAKPVPWV CCCCCCCCCCCCCCH | 73.54 | 29967540 | |
36 | Ubiquitination | SGENKKAKPVPWVEK CCCCCCCCCCCCHHH | 56.26 | 29967540 | |
43 | Ubiquitination | KPVPWVEKYRPKCVD CCCCCHHHHCCCCCC | 36.62 | 29967540 | |
47 | Acetylation | WVEKYRPKCVDEVAF CHHHHCCCCCCHHHC | 37.58 | 26051181 | |
47 | Ubiquitination | WVEKYRPKCVDEVAF CHHHHCCCCCCHHHC | 37.58 | 29967540 | |
48 | Glutathionylation | VEKYRPKCVDEVAFQ HHHHCCCCCCHHHCH | 5.30 | 22555962 | |
63 | Ubiquitination | EEVVAVLKKSLEGAD HHHHHHHHHHCCCCC | 33.45 | 22817900 | |
64 | Ubiquitination | EVVAVLKKSLEGADL HHHHHHHHHCCCCCC | 56.99 | 21890473 | |
64 | Ubiquitination | EVVAVLKKSLEGADL HHHHHHHHHCCCCCC | 56.99 | 21906983 | |
84 | Ubiquitination | YGPPGTGKTSTILAA ECCCCCCHHHHHHHH | 38.86 | 21890473 | |
84 | Ubiquitination | YGPPGTGKTSTILAA ECCCCCCHHHHHHHH | 38.86 | 21906983 | |
114 | Methylation | ELNASDERGIQVVRE ECCCCCCCCCHHHHH | 53.13 | 115491189 | |
124 | Ubiquitination | QVVREKVKNFAQLTV HHHHHHHHCCEEEEE | 58.37 | - | |
139 | Ubiquitination | SGSRSDGKPCPPFKI CCCCCCCCCCCCEEE | 48.73 | 33845483 | |
154 | Phosphorylation | VILDEADSMTSAAQA EEEECHHHHHHHHHH | 30.89 | 28060719 | |
156 | Phosphorylation | LDEADSMTSAAQAAL EECHHHHHHHHHHHH | 21.11 | 28060719 | |
157 | Phosphorylation | DEADSMTSAAQAALR ECHHHHHHHHHHHHH | 16.99 | 28060719 | |
166 | Phosphorylation | AQAALRRTMEKESKT HHHHHHHHHHHCCCC | 24.21 | 28060719 | |
172 | Ubiquitination | RTMEKESKTTRFCLI HHHHHCCCCHHHHHH | 55.82 | 24816145 | |
174 | Phosphorylation | MEKESKTTRFCLICN HHHCCCCHHHHHHHH | 26.03 | - | |
182 | Phosphorylation | RFCLICNYVSRIIEP HHHHHHHHHHHHHHH | 8.73 | 28152594 | |
184 | Phosphorylation | CLICNYVSRIIEPLT HHHHHHHHHHHHHHH | 13.85 | 28152594 | |
191 | Phosphorylation | SRIIEPLTSRCSKFR HHHHHHHHHCCCCCC | 25.49 | - | |
192 | Phosphorylation | RIIEPLTSRCSKFRF HHHHHHHHCCCCCCC | 38.68 | - | |
200 | Ubiquitination | RCSKFRFKPLSDKIQ CCCCCCCCCCCHHHH | 40.57 | 24816145 | |
205 | Ubiquitination | RFKPLSDKIQQQRLL CCCCCCHHHHHHHHH | 38.75 | 33845483 | |
205 | Acetylation | RFKPLSDKIQQQRLL CCCCCCHHHHHHHHH | 38.75 | 25953088 | |
216 | Ubiquitination | QRLLDIAKKENVKIS HHHHHHHHHCCCCCC | 62.04 | 29967540 | |
216 | 2-Hydroxyisobutyrylation | QRLLDIAKKENVKIS HHHHHHHHHCCCCCC | 62.04 | - | |
216 | Acetylation | QRLLDIAKKENVKIS HHHHHHHHHCCCCCC | 62.04 | 25953088 | |
217 | Acetylation | RLLDIAKKENVKISD HHHHHHHHCCCCCCC | 45.56 | 19816155 | |
221 | Ubiquitination | IAKKENVKISDEGIA HHHHCCCCCCCCCEE | 48.34 | 29967540 | |
229 | Phosphorylation | ISDEGIAYLVKVSEG CCCCCEEEEEECCCH | 15.31 | 28152594 | |
232 | Ubiquitination | EGIAYLVKVSEGDLR CCEEEEEECCCHHHH | 37.13 | 21906983 | |
240 | Ubiquitination | VSEGDLRKAITFLQS CCCHHHHHHHHHHHH | 51.98 | 21890473 | |
240 | Ubiquitination | VSEGDLRKAITFLQS CCCHHHHHHHHHHHH | 51.98 | 21906983 | |
243 | Phosphorylation | GDLRKAITFLQSATR HHHHHHHHHHHHHHH | 24.13 | 29759185 | |
247 | Phosphorylation | KAITFLQSATRLTGG HHHHHHHHHHHHHCC | 33.48 | 29759185 | |
249 | Phosphorylation | ITFLQSATRLTGGKE HHHHHHHHHHHCCHH | 31.30 | 29759185 | |
252 | O-linked_Glycosylation | LQSATRLTGGKEITE HHHHHHHHCCHHHHH | 40.37 | 30379171 | |
252 | Phosphorylation | LQSATRLTGGKEITE HHHHHHHHCCHHHHH | 40.37 | 29759185 | |
255 | 2-Hydroxyisobutyrylation | ATRLTGGKEITEKVI HHHHHCCHHHHHHHH | 47.49 | - | |
255 | Ubiquitination | ATRLTGGKEITEKVI HHHHHCCHHHHHHHH | 47.49 | 27667366 | |
255 | Acetylation | ATRLTGGKEITEKVI HHHHHCCHHHHHHHH | 47.49 | 26051181 | |
258 | Phosphorylation | LTGGKEITEKVITDI HHCCHHHHHHHHHHH | 30.74 | 29759185 | |
260 | Ubiquitination | GGKEITEKVITDIAG CCHHHHHHHHHHHCC | 30.22 | 29967540 | |
283 | Phosphorylation | GVFAACQSGSFDKLE CEEEECCCCCHHHHH | 35.97 | 28348404 | |
285 | Phosphorylation | FAACQSGSFDKLEAV EEECCCCCHHHHHHH | 35.20 | 28348404 | |
288 | Ubiquitination | CQSGSFDKLEAVVKD CCCCCHHHHHHHHHH | 46.33 | 32015554 | |
289 (in isoform 2) | Phosphorylation | - | 5.71 | 22617229 | |
290 (in isoform 2) | Phosphorylation | - | 45.20 | 22617229 | |
294 | Ubiquitination | DKLEAVVKDLIDEGH HHHHHHHHHHHHHHH | 39.97 | - | |
322 | Ubiquitination | VENNLSDKQKSIITE HHCCCCHHHHHHHHH | 57.14 | 21906983 | |
324 | Ubiquitination | NNLSDKQKSIITEKL CCCCHHHHHHHHHHH | 49.73 | 22817900 | |
330 | Ubiquitination | QKSIITEKLAEVDKC HHHHHHHHHHHHHHH | 44.33 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFC4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFC4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFC4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1; LYS-6 AND LYS-13, ANDMASS SPECTROMETRY. |