CTF8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CTF8_HUMAN
• UniProt AC: P0CG13
• Protein Name: Chromosome transmission fidelity protein 8 homolog
• Gene Name: CHTF8
• Organism: Homo sapiens (Human).
• Sequence Length: 121
• Subcellular Localization: Nucleus . Associates with chromatin during S phase.
• Protein Description: Chromosome cohesion factor involved in sister chromatid cohesion and fidelity of chromosome transmission. Component of one of the cell nuclear antigen loader complexes, CTF18-replication factor C (CTF18-RFC), which consists of CTF18, CTF8, DCC1, RFC2, RFC3, RFC4 and RFC5. The CTF18-RFC complex binds to single-stranded and primed DNAs and has weak ATPase activity that is stimulated the presence of primed DNA, replication protein A (RPA) and proliferating cell nuclear antigen (PCNA). The CTF18-RFC complex catalyzes the ATP-dependent loading of PCNA onto primed and gapped DNA. It also interacts with and stimulates POLH, which is suggestive of a protein network that coordinates DNA repair, recombination and chromosome cohesion reactions with replication fork progression..
• Protein Sequence: MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
60	Phosphorylation	IVGHHILYGKIIHLE EEEEHHEECEEEEEC	18.77	-
68	Ubiquitination	GKIIHLEKPFAVLVK CEEEEECCCEEEEEE	52.36	29967540
75	Ubiquitination	KPFAVLVKHTPGDQD CCEEEEEECCCCCCC	37.29	29967540
90	O-linked_Glycosylation	CDELGRETGTRYLVT HHHHHHHHCHHHHHH	42.36	30379171
97	Phosphorylation	TGTRYLVTALIKDKI HCHHHHHHHHHCCCC	17.10	-
101	Ubiquitination	YLVTALIKDKILFKT HHHHHHHCCCCCCCC	54.54	29967540
111	Ubiquitination	ILFKTRPKPIITSVP CCCCCCCCCCEEECC	45.62	29967540
120	Ubiquitination	IITSVPKKV------ CEEECCCCC------	47.29	24816145

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CTF8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CTF8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CTF8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTF18_HUMAN	CHTF18	physical	12766176
DCC1_HUMAN	DSCC1	physical	12766176
RFC3_HUMAN	RFC3	physical	12766176

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.