UniProt ID | LFA3_HUMAN | |
---|---|---|
UniProt AC | P19256 | |
Protein Name | Lymphocyte function-associated antigen 3 | |
Gene Name | CD58 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 250 | |
Subcellular Localization |
Isoform 1: Cell membrane Single-pass type I membrane protein. |
|
Protein Description | Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.. | |
Protein Sequence | MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | N-linked_Glycosylation | IYGVVYGNVTFHVPS CEEEEECEEEEECCC | 16.39 | UniProtKB CARBOHYD | |
62 | Ubiquitination | LWKKQKDKVAELENS HHHHHHHHHHHHHCC | 50.83 | 29967540 | |
78 | Ubiquitination | FRAFSSFKNRVYLDT HHHHHHCCCCEEEEE | 45.88 | - | |
94 | N-linked_Glycosylation | SGSLTIYNLTSSDED CCEEEEEECCCCCCC | 32.75 | UniProtKB CARBOHYD | |
109 | N-linked_Glycosylation | EYEMESPNITDTMKF CCEECCCCHHHHHHH | 60.10 | UniProtKB CARBOHYD | |
135 | N-linked_Glycosylation | TLTCALTNGSIEVQC CEEEEEECCEEEEEE | 42.96 | UniProtKB CARBOHYD | |
169 | N-linked_Glycosylation | PMEQCKRNSTSIYFK CHHHHHHCCCEEEEE | 34.82 | 17660510 | |
170 | Phosphorylation | MEQCKRNSTSIYFKM HHHHHHCCCEEEEEE | 27.80 | 29978859 | |
171 | Phosphorylation | EQCKRNSTSIYFKME HHHHHCCCEEEEEEC | 23.77 | 29978859 | |
172 | Phosphorylation | QCKRNSTSIYFKMEN HHHHCCCEEEEEECC | 18.34 | 29978859 | |
174 | Phosphorylation | KRNSTSIYFKMENDL HHCCCEEEEEECCCC | 9.27 | 29978859 | |
195 | N-linked_Glycosylation | TLSNPLFNTTSSIIL EECCCCCCCCCEEEE | 50.56 | UniProtKB CARBOHYD | |
209 | Phosphorylation | LTTCIPSSGHSRHRY EEEECCCCCCCCCCE | 34.86 | - | |
247 (in isoform 3) | Phosphorylation | - | 50.83 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LFA3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LFA3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LFA3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNJA1_HUMAN | DNAJA1 | physical | 16169070 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D02800 | Alefacept (USAN/INN); Amevive (TN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...