| UniProt ID | ATPK_HUMAN | |
|---|---|---|
| UniProt AC | P56134 | |
| Protein Name | ATP synthase subunit f, mitochondrial | |
| Gene Name | ATP5J2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 94 | |
| Subcellular Localization |
Mitochondrion. Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.. | |
| Protein Sequence | MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASVGECPA ------CCCCCCCCC | 16.96 | 22223895 | |
| 3 | Phosphorylation | -----MASVGECPAP -----CCCCCCCCCC | 29.38 | 23401153 | |
| 3 (in isoform 4) | Phosphorylation | - | 29.38 | - | |
| 3 (in isoform 2) | Phosphorylation | - | 29.38 | - | |
| 14 | Ubiquitination | CPAPVPVKDKKLLEV CCCCCCCCCCCEEEE | 58.73 | 33845483 | |
| 22 | Acetylation | DKKLLEVKLGELPSW CCCEEEEECCCCCCE | 41.20 | 25038526 | |
| 28 | Phosphorylation | VKLGELPSWILMRDF EECCCCCCEEEECCC | 39.10 | 25338102 | |
| 32 (in isoform 4) | Phosphorylation | - | 2.58 | 30087585 | |
| 36 | Phosphorylation | WILMRDFSPSGIFGA EEEECCCCCCCCCHH | 23.57 | 27499020 | |
| 38 | Phosphorylation | LMRDFSPSGIFGAFQ EECCCCCCCCCHHHH | 43.24 | 21712546 | |
| 38 (in isoform 3) | Phosphorylation | - | 43.24 | 30087585 | |
| 54 | Acetylation | GYYRYYNKYINVKKG HHHHHCCCEECCCCC | 31.24 | 25825284 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATPK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATPK_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATPK_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARL8B_HUMAN | ARL8B | physical | 16169070 | |
| CPNS1_HUMAN | CAPNS1 | physical | 16169070 | |
| LPP_HUMAN | LPP | physical | 16169070 | |
| PRP4_HUMAN | PRPF4 | physical | 16169070 | |
| NECT2_HUMAN | PVRL2 | physical | 16169070 | |
| ZFPL1_HUMAN | ZFPL1 | physical | 16169070 | |
| KDM1A_HUMAN | KDM1A | physical | 16169070 | |
| CREL1_HUMAN | CRELD1 | physical | 16169070 | |
| F16P1_HUMAN | FBP1 | physical | 16169070 | |
| CC137_HUMAN | CCDC137 | physical | 16169070 | |
| NDUA6_HUMAN | NDUFA6 | physical | 16169070 | |
| HAP1_HUMAN | HAP1 | physical | 16169070 | |
| RLA1_HUMAN | RPLP1 | physical | 16169070 | |
| QCR8_HUMAN | UQCRQ | physical | 22939629 | |
| NDUB9_HUMAN | NDUFB9 | physical | 22939629 | |
| RT34_HUMAN | MRPS34 | physical | 22939629 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |